current user: public

If you have questions about the server, please let us know.

Query: sp|A8MS94|GG2L5_HUMAN Putative golgin subfamily A member 2-like protein 5 OS=Homo sapiens PE=5 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MPSILEDLKSREAMVAFLNSALVSAEEEQQAQLHGQLKEQRVCCQHLAHPVALAQKEPEAAAPTPRTGGDSACGETLQAVENLSYKLARVYSSHECCQIHLLIIGVYIFILast
1 -89.100sp|A8MS94|GG2L5_HUMAN Putative golgin subfamily A member 2-like protein 5 OS=Homo sapiens PE=5 SV=2  ali  100  1MPSILEDLKSREAMVAFLNSALVSAEEEQQAQLHGQLKEQRVCCQHLAHPVALAQKEPEAAAPTPRTGGDSACGETLQAVENLSYKLARVYSSHECCQIHLLIIGVYIFI 110
2 -53.700sp|A8MZ06|GG2L6_HUMAN Putative golgin subfamily A member 2-like protein 6 OS=Homo sapiens PE=5 SV=2  ali follow..  53  1MKSILQDLESQESMVAFLTSAVASADGEQ-ARLRGQLKEQRLRCRCLAHLLAWAQKQPEAAAPAPGTGMDSVCGGTHRALQGAMEKLQSCFMQLMQEKVDLK........ 101
3 -51.300sp|Q9H5Y0|GG2L2_HUMAN Golgin subfamily A member 2-like protein 2 OS=Homo sapiens PE=2 SV=1  ali follow..  61  1MPNIPGDLESQEAMVAFFNSAGASAQEEQ-----------RVCCQPLAHPVASSQKKPEVAAPAPESGGESVFGETHRALQGAMEKLQE..................... 78
4 -50.500sp|Q8NCE8|GG2L3_HUMAN Golgin subfamily A member 2-like protein 3 OS=Homo sapiens PE=2 SV=1  ali follow..  62  1MPNIPGDLESREAMVAFFNSAGASAQEEQ-----------RVCCQPLAHPVASSQKKPEVAAPAPESGGESVFGETHRALQGAMEKLQE..................... 78
5 -41.500sp|Q08379|GOGA2_HUMAN Golgin subfamily A member 2 OS=Homo sapiens GN=GOLGA2 PE=1 SV=3  ali   60  123MPSIPEDLESREAMVAFFNSAVASAEEEQ-ARLRGQLKEQRVRCRRLAHLLASAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLDTIGEYIAL 249
6 -39.600sp|Q08379|GOGA2_HUMAN Golgin subfamily A member 2 OS=Homo sapiens GN=GOLGA2 PE=1 SV=3  ali   54  1.............................QARLRGQLKEQRVRCRRLAHLLASAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLDTIGEYIAL 99
7 -34.200sp|Q9HBQ8|GGA2B_HUMAN Golgin subfamily A member 2B OS=Homo sapiens GN=GOLGA2B PE=2 SV=1  ali follow..  38  13MPSIPEDLESQKAMVAFFNSAVASAEEEQ-ARLCGQLKECTASAWLICWPRPRRQPQPQELGVIPCVGRPTRPCGPWRSCGRVHRTVP...................... 104
8 -26.100sp|A8MQT2|GOG8B_HUMAN Golgin subfamily A member 8B OS=Homo sapiens GN=GOLGA8B PE=2 SV=2  ali   23  48RLREREKRLQQLAEPQSDLEELKHENKSA-LQLEQQVKELQEKLGQVMETLTSAEKEPEAAVPASGTGGESSGLMDLLDLREHVEKLELGFIQYRRER............ 148
9 -24.000sp|A6NC78|GOG8I_HUMAN Putative golgin subfamily A member 8I OS=Homo sapiens GN=GOLGA8IP PE=5 SV=2  ali   16  63SLQQLAKPQSVFEEPNNENKSALQLEQQV-KELQEKLGEEHLEAASQQNQQLTAQ-LSLMALPGEGHGGEHLDSEGEEAPQPMPSVPESSFMDHLEEKADLS........ 170
10 -23.900sp|A7E2F4|GOG8A_HUMAN Golgin subfamily A member 8A OS=Homo sapiens GN=GOLGA8A PE=1 SV=2  ali   24  76RLREREKRLQQLAEPQSDLEELKHENKSA-LQLEQQVKELQEKLGQVMETLTSAEKEPEAAVPASGTGGESSGLMDLLEEKADLREHV...................... 162
11 -23.800sp|P0CG33|GOG6D_HUMAN Putative golgin subfamily A member 6D OS=Homo sapiens GN=GOLGA6D PE=5 SV=1  ali   21  3.......................NNEKKSALQLEQQVKELKLDEEHLEAASQRNQQLETQLSPGEGDGGDSEEEEAPRPTPNIPEDLESSFMDLPKEKADGT........ 95
12 -23.500sp|Q9NYA3|GOG6A_HUMAN Golgin subfamily A member 6A OS=Homo sapiens GN=GOLGA6A PE=1 SV=3  ali   21  3.......................NNEKKSALQLEQQVKELKLDEEHLEAASHQNQQLETQLSPGEGDGGDSEEEEAPRPTPNIPEDLESSFMDLPKEKADGT........ 95
13 -23.200sp|A6NDK9|GOG6C_HUMAN Putative golgin subfamily A member 6C OS=Homo sapiens GN=GOLGA6C PE=5 SV=1  ali   22  3.......................NNEKKSALQLEQQVKELKLDEEHLEAASQRNQQLETQALPGEGDGGDSEEEEAPRPTPNIPEDLESSFMDLPKEKADGT........ 95
14 -20.900sp|A6NDN3|GOG6B_HUMAN Putative golgin subfamily A member 6B OS=Homo sapiens GN=GOLGA6B PE=5 SV=3  ali   21  3.......................NNEKKSALQLEQQVKELKLDEEHLEAASQQNQQLETQLSPGEGDGGDSEEEEAPRPTPNIPEDLESSFMDLPKEKADGT........ 95
15 -17.400sp|A6NP81|GG8L2_HUMAN Golgin subfamily A member 8-like protein 2 OS=Homo sapiens PE=2 SV=2  ali   17  63KLRQLAKPQSVFEEQNNENKSTLQLEQQV-KELQEKLGEEHLEVASQQNQQLTAQ-LSLMALPGEGHGGEHLDSEGEEAPQPMPSVPE...................... 148
16 -15.900sp|Q08379|GOGA2_HUMAN Golgin subfamily A member 2 OS=Homo sapiens GN=GOLGA2 PE=1 SV=3  ali   82  273MPSIPEDLESREAMVAFFNSAVASAEEE.................................................................................. 300
17 -9.140sp|A6NN73|GOG8C_HUMAN Putative golgin subfamily A member 8C OS=Homo sapiens GN=GOLGA8C PE=5 SV=2  ali follow..  27  349LREQEERLQQLAEPQNSFKELNNENKSVLQL-EQQVKELQEKLGKRLAHPVASAQKEPEAAVPAPGPGGESSGFMDHLEEKADLSELV...................... 435

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.