current user: public

If you have questions about the server, please let us know.

Query: sp|O95976|IGSF6_HUMAN(removed signalp:1-27) Immunoglobulin superfamily member 6 OS=Homo sapiens GN=IGSF6 PE=2 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst CTLSVTQPWYLEVDYTHEAVTIKCTFSATGCPSEQPTCLWFRYGAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLVVREIKLLSKELRSFLTALVSLLSVYVTGVCVAFILLSKSKSNPLRNKEIKEDSQKKKSARRIFQEIAQELYHKRHVETNQQSEKDNNTYENRRVLSNYERPLast
1 -89.100sp|O95976|IGSF6_HUMAN(removed signalp:1-27) Immunoglobulin superfamily member 6 OS=Homo sapiens GN=IGSF6 PE=2 SV=2  ali  100  1CTLSVTQPWYLEVDYTHEAVTIKCTFSATGCPSEQPTCLWFRYGAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLVVREIKLLSKELRSFLTALVSLLSVYVTGVCVAFILLSKSKSNPLRNKEIKEDSQKKKSARRIFQEIAQELYHKRHVETNQQSEKDNNTYENRRVLSNYERP 214
2 -51.900sp|Q15116|PDCD1_HUMAN(removed signalp:1-24) Programmed cell death protein 1 OS=Homo sapiens GN=PDCD1 PE=2 SV=3  ali follow..  15  8.WNPPTFSPALLVVTEGDNATFTCSFSNT---SESFVLNWYRMSPSNQTDKLAAFPEDRDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAI--SLAPKAQIKESLRAELRVTERRAEVPTAH--PSPSPRPAGQFQTLVVGVVGGLLGSLVLLVARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPPEQTEYATIVFP 230
3 -49.100sp|Q96BF3|TMIG2_HUMAN(removed signalp:1-22) Transmembrane and immunoglobulin domain-containing protein 2 OS=Homo sapiens GN=TMIGD2 PE=1 SV=2  ali follow..  15  1..LSVQQGPNLLQVRQGSQATLVCQVDQAT-AWERLRVKWTKDGAILCQPYITNGSLSLGGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAV--EIPELEEAEGNITRLFVDPDDPTQNRNRIASFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGAPKKSEDCSGEG--KDQRGQSIYSTSFPQPAPRQP 212
4 -48.600sp|P09564|CD7_HUMAN(removed signalp:1-25) T-cell antigen CD7 OS=Homo sapiens GN=CD7 PE=1 SV=1  ali follow..  12  1.AQEVQQSPHCTTVPVGASVNITCSTSGG-------LRGIYLRQLGPQPQDIIYYEDGVVPTTRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVN------VYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMS-CNTLSSP 211
5 -47.600sp|Q9H106|SIRPD_HUMAN(removed signalp:1-29) Signal-regulatory protein delta OS=Homo sapiens GN=SIRPD PE=2 SV=2  ali follow..  14  1..FHVQQTEMSQTVSTGESIILSCSVPNT---LPNGPVLWFKGTGPNRKLIYNFKQGNFPKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGR-AIKEYQSGRGTQVFVTEQN--PRPPKNRPAGRAGSRAHHDAHTCLSA.................................................................... 140
6 -47.100sp|P40259|CD79B_HUMAN(removed signalp:1-28) B-cell antigen receptor complex-associated protein beta chain OS=Homo sapiens GN=CD79B PE=1 SV=1  ali follow..  13  15.CSRIWQSPRFIARKRGFTVKMHCYMNSA-----SGNVSWLWKQEMDENPQQLKLEKG-----RMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNT---SEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGE.......................... 196
7 -45.700sp|P10966|CD8B_HUMAN(removed signalp:1-18) T-cell surface glycoprotein CD8 beta chain OS=Homo sapiens GN=CD8B PE=1 SV=1  ali follow..  15  1.NSVLQQTPAYIKVQTNKMVMLSCEAKIS---LSNMRIYWLRQRQAPSSDSHHEIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPE-----LTFGKGTQLSVVDFLPTTAQPTKKSTCRLPRPETQKGPLCSP..................................................................... 152
8 -45.500sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  19  1.DIVLTQSPLSLPVTPGEPASISCRSSQNLLXSXGXYLDWYLXKPGXSPXLLIYLGSNRASGVRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQTP-----LTFGGGTNVEIKR.................................................................................................. 112
9 -44.800sp|A6NJW9|CD8BL_HUMAN(removed signalp:1-18) Putative T-cell surface glycoprotein CD8 beta-2 chain OS=Homo sapiens GN=CD8BP PE=5 SV=2  ali follow..  18  1.NSVLQQTPAYIKVQTNKMVMLSCEAKIS---LSNMCIYWLRQRQAPSSDSHHEGEEVEQEKIAVFRD--ASRFILNLTSVKPEDSGIYFCMIVGSPE-----LTFGKGTQLSVVVDFLPTTAQPTKKSTLLPRPETQKGPLCS...................................................................... 152
10 -44.800sp|O14931|NCTR3_HUMAN(removed signalp:1-18) Natural cytotoxicity triggering receptor 3 OS=Homo sapiens GN=NCR3 PE=1 SV=1  ali follow..  21  1..LWVSQPP-EIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKE-VRNGTPEFRGRLAPLASSRDHQAELHIRDVRGHDASIYVCRVEVLGL----GVGTGNGTRLVVEKEHPQLGAGTVLLLRAG---FYAVSFLSVA..................................................................... 137
11 -44.400sp|P01737|TVA3_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region PY14 OS=Homo sapiens PE=1 SV=1  ali follow..  22  2...SVTQLGSHVSVSEGALVLLRCNYSSS----VPPYLFWYVQYPNQGLQLLLKYTSAAINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSDLEPNSSSKIIFGSGTRLSIR................................................................................................... 115
12 -44.000sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  15  1.DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWS-----WTFGQGTKVEIKR.................................................................................................. 113
13 -44.000sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  19  1.DVVMTQSPLFLPVTLGEPASIQCRSSQSLVYRXXTYLXWYLQKPGQSPELLIYLSSYRDSGVRFSDSGSGTDFTLKITRVQAEDVGVYYCMQATXSP-----YTFGQGTKLXIKR.................................................................................................. 113
14 -43.900sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  19  1.DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSGFDYLNWYLQKPGQSPXLLIYALSNRASGVRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQAP-----ITFGQGTRLEIKR.................................................................................................. 113
15 -43.500sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  17  4GDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSGYNYLDWYLQKPQQSPQLLIYLGSNRASGVRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQTP-----QTFGQGTKVEIKR.................................................................................................. 117
16 -43.500sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  20  2.DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSGNTYLNWYLQKAGQSPQLLIYTLSYRASGVRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEIP-----YTFGQGTKLEIRR.................................................................................................. 115
17 -43.200sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  18  1.DIVMTQSPDSLAVSLGERATINCKSSQSYSSNSKNYLAWYQQKPGQPPKLLIYWASTRESGVRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTP-----YSFGQGTKLEIKR.................................................................................................. 114
18 -43.200sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.EIVLTQSPGTLSLSPGESATLSCRASQS----VSSNLAWYQQKRGQSPRLLIRDASSRANGIRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYSTSP-----YTFGQGTKLEIKR.................................................................................................. 108
19 -43.200sp|P01732|CD8A_HUMAN(removed signalp:1-21) T-cell surface glycoprotein CD8 alpha chain OS=Homo sapiens GN=CD8A PE=1 SV=1  ali follow..  2...QFRVSPLDRTWNLGETVELKCQVLLSN---PTSGCSWLFQPRGAAASPTFLLYLSQNKTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNS-----IMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYGTCGVLLLSLVITLYCNHRNRRRVCKCGDKPSLSARY............ 213
20 -43.000sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.DIQMTQSPSSVSASVGDRVTITCRASQD----ISHWLAWYQQKSGKAPKLLIYSASSLENGVRFSGSGSGTEFTLTISSLQPEDFATYFCQQAHSVP-----LTFGGGTTVDIKR.................................................................................................. 108
21 -43.000sp|P16410|CTLA4_HUMAN(removed signalp:1-37) Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens GN=CTLA4 PE=1 SV=3  ali follow..  16  1..MHVAQPA-VVLASSRGIASFVCEYASPG-KATEVRVTVLRQADSQVTEVCAATYMMGNDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELM-YPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLT..................................................................... 145
22 -43.000sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  19  1.DIQMTQSPSTLSASVGDRVTITCRASQS----INTWLAWYQQKPGKAPKLLMYKASSLESGVRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSDS-----KMFGQGTKVEVKG.................................................................................................. 108
23 -42.800sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  14  1.DIQMTQSPSSLSATVGDRVTLLCEASQSVLESGNTFLAWYQQKPKKAPKLLIYDASNLETGVRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLP-----STFGVASKVESK................................................................................................... 111
24 -42.800sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  21  1.EIVLTQSPGTLSLSPGERATLSCRASQS---VSSSYLAWYQQKPGQAPRLLIYGASSRATGIRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSSP-----WTFGQGTKVEIKR.................................................................................................. 109
25 -42.800sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  18  1.DIQMTQSPSSLSASVGDRVTITCRASQD----ITNYVNWFQQRPGQAPKVLIYGASILETGVRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDTLP-----LTFGGGTKVDIKR.................................................................................................. 108
26 -42.700sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  17  1.DIVMTQSPDSLAVSLGERATINCKSSQSYSSDNKNYLAWYQQKPGQPPKLLIYWASTRESGVRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNLP-----WTFGQGTKVEIKR.................................................................................................. 114
27 -42.700sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  17  1.DVQMTQSPSSLSASVGDRVIITCRASQS----SVDYLNWYQQKPGKAPKLLIFDTSNLQSGVRFSGGRSGTDFTLTISSLQPDDFATYYCQQSYTNP----EVTFGGGTTVDIKR.................................................................................................. 109
28 -42.700sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.DIQMTQSPSSLSASVGDRVTITCQASQD----IRKHLNWYDQKPGKAPRLLIYGASTLETGVRFSGSGSGTDFTLTISTLQPEDIGNYYCQQYDNVP-----ITFGQGTRVENKG.................................................................................................. 108
29 -42.700sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.DIQMTQSPSPLSASVGDSVTITCQASQD----IRNSLIWYQQKPGKAPKFLIYDAENLEIGVRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNLP-----YTFGQGTKLEIKR.................................................................................................. 108
30 -42.600sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  19  1.DIQMTQSPSSLSASVGDRVTITCRASQS----ISNYLNWYQQKPGKAPKLLIYAASSLQSGVRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYST-----LITFGQGTRLEIK................................................................................................... 107
31 -42.600sp|P01733|TVB1_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region YT35 OS=Homo sapiens GN=TRBV12-3 PE=1 SV=1  ali follow..  21  2....VIQSPRHEVTEMGQEVTLRCKPISGH-----NSLFWYRQTMMRGLELLIYFNNNVEDRFSAKMP-NASFSTLKIQPSEPRDSAVYFCASSFSTCSANYGYTFGSGTRLTV.................................................................................................... 113
32 -42.600sp|P04437|TVA2_HUMAN(removed signalp:1-21) T-cell receptor alpha chain V region CTL-L17 OS=Homo sapiens GN=TCRA PE=2 SV=1  ali follow..  17  6.DQQVKQNSPSLSVQEGRISILNCDYTNS----MFDYFLWYKKYPAEGPTFLISISSIKDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAAKGAGTAS--KLTFGTGTRLQVT................................................................................................... 117
33 -42.500sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.DIQMTQSPSSLSASVGDRVTITCQASQD----ISIFLNWYQQKPGKAPKLLIYDASKLEAGVRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNLP-----LTFGGGTKVDFKR.................................................................................................. 108
34 -42.500sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.DIQMTQSPSSLSASVGDRVTITCRASQS----ISSYLSWYQQKPGKAPQVLIYAASSLPSGVRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYITP-----TSFGQGTRVEIKR.................................................................................................. 108
35 -42.500sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  17  1.DIQMTQSPSSLSVSVGDRVTITCQASQN----VNAYLNWYQQKPGLAPKLLIYGASTREAGVRFSGSGSGTDFTFTISSLQPEDIATYYCQQYNNW-----PPTFGQGTKVEVKR.................................................................................................. 108
36 -42.500sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  21  1.EIVLTQSPGTLSLSPGERATLSCRAALL---SSRGYLAWYQQKPGQAPRLLMYGASSRATGIRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSS-----PRSFGQGTKVEIK................................................................................................... 108
37 -42.500sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  15  1.DIQMTQSPSSLSASVGDRVTIICRASQG----IRNDLTWYQQKPGKAPKELIYAASNLQSGVRFSGSGAGTEFTLTISSLQPEDFATYYCLQQNSYP-----RSFGQGTKVEIKR.................................................................................................. 108
38 -42.400sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  16  1.DIQMTQSPSSLSASVGDRVTITCRAGHN----ITNFLSWYQQKPGKAPTLLIYAVSNLQVGVRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNFS-----FTFGGGTKVDNK................................................................................................... 107
39 -42.400sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  18  1.DIQMTQSPSTQPASVGDRVTITCRASQS----INIWLAWYQQKPEKAPKLLIYKASTLETGVRFSGSGSGTEFTLTINSLQPDDFATYYCQQYSRYP-----YTFGQGTKLDIKR.................................................................................................. 108
40 -42.400sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.DIQMTQSPSSLSASVGDRVTITCQASQD----IIKYLNWYQQTPGKAPKLLIYEASNLQAGVRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSLP-----YTFGQGTKLQITR.................................................................................................. 108
41 -42.400sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.XIXMTQSPSSLSASVGDRVTITCRAGQS----VNKYLNWYQQKPGKAPKVLIFAASSLKSGVRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTTP-----YTFGPGTKVEMTR.................................................................................................. 108
42 -42.300sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  18  1.DIQMTQSPSTLSVSVGDRVTITCEASQT----VLSYLNWYQQKPGKAPKLLIYAASSLETGVRFSGQGSGTXFTFTISSVXPXXFATYYCQXYLDLP-----RTFGQGTKVDLK................................................................................................... 107
43 -42.300sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  15  1.DIQMTQSPSTLSASVGDRVAITCRASQN----ISSWLAWYQQKPGKAPKVLIYKSSSLESGVRFSGSGSGTDFTLTISSLXPXXFATYYCQQY------NTFFTFGPGTKVDIKR.................................................................................................. 107
44 -42.300sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.EIVLTQSPGTLSLSPGERATLSCRASQS---VSSGYLGWYQQKPGQAPRLLIYGASSRATGIRFSGSGSGTDFTLTISRLEPEDFAVYYCQQY-----GSLGRTFGQGTKVEIKR.................................................................................................. 109
45 -42.300sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  19  1.DIQMTQSPSSLSASVGDRVTITCRASQG----IRNDLTWYQQKPGTAPKRLIYGATSLQSGVRFSGSGSGTEFTLTINSLQPEDFATYYCLQYSSFP-----WTFGQGTKVEVK................................................................................................... 107
46 -42.200sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  15  1.DIQMTQSPSSLSASVGDRVTITCQASQD----ISDYLNWYQQKPGKAPKLLIYDASNLESGVRFSGGGSGAHFTFTISSLQPEDIATYYCQQYDYLP-----WTFGQGTKVEIKR.................................................................................................. 108
47 -42.200sp|P04436|TVA1_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region HPB-MLT (Fragment) OS=Homo sapiens PE=2 SV=1  ali follow..  17  2...KVTQAQTEISVVEKEDVTLDCVYETR---DTTYYLFWYKQPPSGELVFLIRRNSFDSGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALDSSASKI----IFGSGTRLSIR................................................................................................... 111
48 -42.100sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.DIQMTQSPSSLSASVGDRVTITCQASQD----INHYLNWYQQGPKKAPKILIYDASNLETGVRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLP-----RTFGQGTKLEIKR.................................................................................................. 108
49 -42.100sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.EIVLTQSPGTLSLSPGERATLSCRASQS---VSNSYLAWYQQKPGQAPRLLIYGASSRATGIRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSS-----PQTFGQGSKVEIKR.................................................................................................. 109
50 -41.900sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.DIQLTQSPSSLSASVGDRVTITCRASQS----VYNYVAWFQQKPGKAPKSLIYDASTLQSGVNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSYP-----YTFGQGTKVQIKR.................................................................................................. 108
51 -41.700sp|P03979|TVC_HUMAN(removed signalp:1-17) T-cell receptor gamma chain V region PT-gamma-1/2 OS=Homo sapiens GN=TRGV3 PE=2 SV=1  ali follow..  18  2.SSNLEGRTKSVTRQTGSSAEITCDLTVT----NTFYIHWYLHQEGKAPQRLLYYDVSTSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRXK-NYYKKLFGSGTTLVVT................................................................................................... 119
52 -41.600sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  18  1.DIVMTQSPDSLAVSLGERATINCKSSQSYSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVRFSGSGSGTDFTLTISSLQAEDVAVYYCQQY------DTIPTFGGGTKVEIK................................................................................................... 112
53 -41.600sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  19  1.DIQMTXSPSSLSASVGXRVTITCRASXT----ISSYLXWYXXKPGKAPXLLIYAASXLHSGVRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSSP-----TTFGXGTRLXIKR.................................................................................................. 108
54 -41.600sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  21  1.EIVLTQSPGTLSLSPGERATLSCRASQS---VSSSYLAWYQQKPGQAPRLLIYGASSRATGIRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTS-----PRTFGQGTKVEIK................................................................................................... 108
55 -41.500sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  19  1.QSVLTQPP-SASGTPGGRVTISCSGSSSNV-GSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSL---DGYVFGTGTKVTVLR.................................................................................................. 112
56 -41.400sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.QSALTQPR-SVSGSPGQSLTISCSGAPCDVDGCE-SVSWYQQHPGKAPKLIIYGFSNRPSGVRFSGSKSGDAASLTISGLQVEDEADYYCSSYADSS-----VIFGAGTKLTVLR.................................................................................................. 110
57 -41.400sp|P01824|HV206_HUMAN Ig heavy chain V-II region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  18  1.RLQLQESGP-GLVKPSETLSLTCIVSGGPIRRTGYYWGWIRQPPGKGLEWIGGVYYTGRGRVTISVDTSRNQFSLNLRSMSAADTAMYYCARGNPPPYYDGIDVWGQGTTVHVSS.................................................................................................. 129
58 -41.300sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.QSVLTQPP-SVSGTPGQRVTISCSGGSSN-GTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRL---SAVVFGGGTQLTVLR.................................................................................................. 112
59 -41.300sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.EIVLTQSPGTLSLSPGERATLSCRASQS---VSNSFLAWYQQKPGQAPRLLIYVASSRATGIRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP-----STFGQGTKVELK................................................................................................... 108
60 -41.300sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  21  1.SYELTQPP-SVSVSPGQTARITCSANAL----PNQYAYWYQQKPGRAPVMVIYKDTQRPSGIRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNS-----ASIFGGGTKLTVLG.................................................................................................. 107
61 -41.300sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  21  1.QSALTQPA-SVSGSPGQSITISCTGTTSDV-GGYDFVSWYQQHPGKAPKLLIYDVNSRPSGIRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTTN---SRAVFGGGTKLSVLG.................................................................................................. 112
62 -41.300sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  21  1.EIVMTQSPATLSVSPGERATLSCRASQS----VSNNLAWYQQKPGQPPRLLIYGASTRATGIRFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNWP----PWTFGQGTRVEIK................................................................................................... 108
63 -41.200sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  18  1.EIVMTQSPVTLSVSPGERATLSCRASQS---ISNSYLAWYQQKPSGSPRLLIYGASTRATGIRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNW-----PPTFGQGTRVEIK................................................................................................... 108
64 -41.200sp|P01817|HV204_HUMAN Ig heavy chain V-II region MCE OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.QITLKESGP-TLVKPTETLTLTCTFSGFSLSTSGVGVGWIRQRPGKALEWLAFINWDDRSRLTGTKDTSRNQVVLTITNMDPVDSGTYFCAHRPPWRFTGGFDXWGQGTLVTVSS.................................................................................................. 125
65 -41.200sp|P04435|TVB2_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region CTL-L17 OS=Homo sapiens GN=TCRB PE=2 SV=1  ali follow..  20  2....VSQNPRHNITKRGQNVTFRCDPISEH-----NRLYWYRQTLGQGPEFLTYFQNEASDRFSAERP-KGSFSTLEIQRTEQGDSAMYLCASSLAG--LNQPQHFGDGTRLSI.................................................................................................... 111
66 -41.100sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  20  2....VLTQPPSVSVAPGETARLTCGGNDI----GSESVHWYQQKPGQAPVLVIYFDRDRPSGIRFSGSNSGNTATLTISRVEAGDEADYYCQLWDSSS---EHVVFGGGTKLTVLSQPK............................................................................................... 111
67 -41.000sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  22  1.HSALTQPA-SVSGSLGQSITISCTGTSSDV-GGYNYVSWFQQHPGTAPKLIISEVRNRPSGVRFSGSKSANTASLTISGLQAEDEADYYCSSYTSSN----SVVFGGGTKLTVLG.................................................................................................. 111
68 -41.000sp|P01814|HV201_HUMAN Ig heavy chain V-II region OU OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.QVTLTESGP-ALVKPKQPLTLTCTFSGFSLSTSRMRVSWIRRPPGKALEWLARIXXXDRTRLSISKNDSKNQVVLIMINVNPVDTATYYCARVVNSVMAGYYYYWGKGTTVTVSS.................................................................................................. 126
69 -41.000sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  19  1.XIVLTXSPGTLSLSPGXRAALSCRASQS---LSGNYLAWYQQKPGQAPRLLMYGVSSRATGIRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSS-----PFTFGQGSKLEIK................................................................................................... 108
70 -41.000sp|Q5JXA9|SIRB2_HUMAN(removed signalp:1-32) Signal-regulatory protein beta-2 OS=Homo sapiens GN=SIRPB2 PE=2 SV=1  ali follow..  11  6.DWQVLQPEGPMLVAEGETLLLRCMVVGS---CTDGMIKWVKVSTQDQQEIYNFKRGSFPPMIQRTSEPLNCDYSIYIHNVTREHTGTYHCVRF-DGLSEHSEMKSDEGTSVLVKGAGDPDLWIIQPQELVLGTTGDTVFLNCTVLGDGPPGPIRWFQGAGLSREA-NFGGISHPKETAVQASNNDFSILLQNVSSEDAGTYYCVKFQRK.... 216
71 -40.800sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  22  1.QSALTQPP-RVSGSPGQSVTISCTGSYSNV-TGYNHVSWYQQDPGKVPKLMIYDVDKRPSGVRFSGSKSANTASLTISGLQANNEADYYCSSYGGT----YSLIFGGGTKLTVLG.................................................................................................. 111
72 -40.800sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  20  1.QSALTQPR-SVSGSPGQSVTISCTGTSSDV-GAYNSVSWYQQHPGKAPKLMIFDVTKRPSGVRLSGSKSGDTASLTISGLRADDEADYYCCSYAGR----YSVIFGGGTKLTVLG.................................................................................................. 111
73 -40.800sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  21  1.QSALTQPP-SASGSLGQSVTISCTGTSSDV-GGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSD----NFVFGTGTKVTVLG.................................................................................................. 111
74 -40.800sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  19  1.QSVLTQPP-SVSAAPGQKVTISCSGGSTNI--GNNYVSWHQHLPGTAPKLLIYEDNKRPSGIRISASKSGTSATLGITGLRTGDEADYYCATWDSSL---NAVVFGGGTKVTVLG.................................................................................................. 111
75 -40.600sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  20  2...DLTQPP-SVSVSPGQTASITCSGDKL----GDKDVCWYQQRPGQSPVLVIYQDNQRSSGIRFSGSNSGNTATLTISGTQAMDEADYYCQAWDSMS-----VVFGGGTRLTVLS.................................................................................................. 106

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.