current user: public

If you have questions about the server, please let us know.

Query: sp|O96007|MOC2B_HUMAN Molybdopterin synthase catalytic subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNSLast
1 -95.000sp|O96007|MOC2B_HUMAN Molybdopterin synthase catalytic subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1  ali  100  1MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS 188
2 -18.200sp|Q9NS73|MBIP1_HUMAN MAP3K12-binding inhibitory protein 1 OS=Homo sapiens GN=MBIP PE=1 SV=2  ali follow..  11  2.................................................................AAATELNRPSSGDRN-LERRCRPNLSREVLYEIF-RSLHTLVGQLDLRDDVVKITIWNKLQSLSAFQPALLFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMG............. 110
3 -8.640sp|O96033|MOC2A_HUMAN Molybdopterin synthase sulfur carrier subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1  ali follow..  11  63YVELGDQLLVLQPGDEIAVIPPISGG.................................................................................................................................................................. 88
4 -7.310sp|Q13724|MOGS_HUMAN Mannosyl-oligosaccharide glucosidase OS=Homo sapiens GN=MOGS PE=1 SV=5  ali   171..........................................................IQQVTLKIPISIEFVFESGSAQAGGNQALPRLAGSLLTQALESHAEGFRERFEKTFQLGQAALSGLLGGIG-GQGLVLPDIGVEGSEQKVDPALFPPVPLFTAVP--SRSFFPRGFLW............ 300
5 -7.080sp|Q96JX3|SRAC1_HUMAN Protein SERAC1 OS=Homo sapiens GN=SERAC1 PE=2 SV=1  ali   13  95...............DVLFIHGLMGAAFKTWRQQDSEQAVIEKPM----DEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMERKSIAFRSNELLRKLRAAGVGDRPV--VWISHSMGGLLVKKMLLIIFYSVPHHGSRLAEYSVNIRYLLFPSLEVKE..................... 258
6 -6.760sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2  ali   14  54.................SLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILD-SALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFIREGGTHQQ........................................... 188
7 -6.720sp|O60674|JAK2_HUMAN Tyrosine-protein kinase JAK2 OS=Homo sapiens GN=JAK2 PE=1 SV=2  ali   12  84.GAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLDHIKLLQYTSQICKGMELGTKRYIHR----DLATRNILVENENRVKIGDFGLTKVLPQD-PGESPIWESKFSVASDVW............ 288
8 -6.710sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2  ali follow..  11  11LKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKST-----LKGLEYLHFMRKIDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRTPFWEIGYNCVADIW............ 205
9 -6.680sp|Q96JX3|SRAC1_HUMAN Protein SERAC1 OS=Homo sapiens GN=SERAC1 PE=2 SV=1  ali   20  1..........................................................................VEYDTSLSDWRARCPMERKSIAFRSNELLRKLRAAGVGDRPV--VWISHSMGGLLVKKMLLIIFYSVPHHGSRLAEYSVNIRYL.............................. 99
10 -6.630sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2  ali follow..  11  14LKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQST-----LKGLEYLHFMRKIDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRTPFWEIGYNCVADIW............ 208

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.