current user: public

If you have questions about the server, please let us know.

Query: sp|O96033|MOC2A_HUMAN Molybdopterin synthase sulfur carrier subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGGLast
1 -65.500sp|O96033|MOC2A_HUMAN Molybdopterin synthase sulfur carrier subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1  ali  100  1MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG 88
2 -30.600sp|Q9BTM9|URM1_HUMAN Ubiquitin-related modifier 1 homolog OS=Homo sapiens GN=URM1 PE=1 SV=1  ali follow..  21  1MAAPLSVEVEFGGGAELLFDIKKHRVTLPEPWDIRNLLIWIKKNLLKERSVRPGILVLINDADWELGELDYQLQDQDSVLFISTLHGG 101
3 -8.650sp|O96007|MOC2B_HUMAN Molybdopterin synthase catalytic subunit OS=Homo sapiens GN=MOCS2 PE=1 SV=1  ali follow..  11  1..............................................................MSSLEISSSCFSLETKLPLSPPLVED 26
4 -8.190sp|Q8TAT6|NPL4_HUMAN Nuclear protein localization protein 4 homolog OS=Homo sapiens GN=NPLOC4 PE=1 SV=3  ali   14  1MAESIIIRV------QSPDGVKR--ITATKRETAATFLKKVAKEF-GFQNNGFSVYINRNKTGEITASSNKSLNLGDLLFL....... 77
5 -7.970sp|P63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 OS=Homo sapiens GN=SUMO1 PE=1 SV=1  ali follow..  16  32.....................SEIHFKVKMTTHLKKLKESYCQR---QGVPMNSLRFLFEGQRIADNHKELGMEEEDVIEVYQEQTGG 97
6 -7.870sp|Q6EEV6|SUMO4_HUMAN Small ubiquitin-related modifier 4 OS=Homo sapiens GN=SUMO4 PE=1 SV=2  ali follow..  18  28.....................SVVQFKIKRQTPLSKLMKAYCEP---RGLSMKQIRFRFGGQPISGTDAQLEMEDEDTIDVFQQPTGG 93
7 -7.820sp|P55854|SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens GN=SUMO3 PE=1 SV=2  ali follow..  19  27.....................SVVQFKIKRHTPLSKLMKAYCER---QGLSMRQIRFRFDGQPINETDAQLEMEDEDTIDVFQQQTGG 92
8 -7.770sp|Q504T8|MIDN_HUMAN Midnolin OS=Homo sapiens GN=MIDN PE=2 SV=2  ali follow..  14  28.AAPMSLAI------HSTTG-TRYDLAVPPDETVEGLRKRLSQR-----PKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAG 105
9 -7.700sp|P61956|SUMO2_HUMAN Small ubiquitin-related modifier 2 OS=Homo sapiens GN=SUMO2 PE=1 SV=1  ali follow..  19  28.....................SVVQFKIKRHTPLSKLMKAYCER---QGLSMRQIRFRFDGQPINETDAQLEMEDEDTIDVFQQQTGG 93
10 -7.270sp|Q6IPM2|IQCE_HUMAN IQ domain-containing protein E OS=Homo sapiens GN=IQCE PE=1 SV=2  ali   11  155.IVIIQSALRAHLARARHSATGKRTTTAASTRRRSASATHGDASSPPFLAALPDPSPSGPQALAPLPGDDVNSDDSDDIVIAPPTK.. 241

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.