current user: public

If you have questions about the server, please let us know.

Query: sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst DIQMTQSPSTLSASVGDRVTITCRASQSINTWLAWYQQKPGKAPKLLMYKASSLESGVPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSDSKMFGQGTKVEVKGLast
1 -75.400sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali  100  1DIQMTQSPSTLSASVGDRVTITCRASQSINTWLAWYQQKPGKAPKLLMYKASSLESGVPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSDSKMFGQGTKVEVKG 108
2 -75.100sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  74  1DIQMTQSPSSLSASVGDRVTITCQASQDIRKHLNWYDQKPGKAPRLLIYGASTLETGVPSRFSGSGSGTDFTLTISTLQPEDIGNYYCQQYDNVPITFGQGTRVENKG 108
3 -73.800sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  74  1DIQMTQSPSSLSASVGDRVTITCRAGHNITNFLSWYQQKPGKAPTLLIYAVSNLQVGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNFSFTFGGGTKVDNK. 107
4 -73.700sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  74  1DIQMTQSPSPLSASVGDSVTITCQASQDIRNSLIWYQQKPGKAPKFLIYDAENLEIGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNLPYTFGQGTKLEIK. 107
5 -73.700sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  79  1DIQMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQKPGKAPKLLIYAASSLQSGVTSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYSTLITFGQGTRLEIK. 107
6 -73.600sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  80  1DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLTWYQQKPGTAPKRLIYGATSLQSGVPSRFSGSGSGTEFTLTINSLQPEDFATYYCLQYSSFPWTFGQGTKVEVK. 107
7 -73.600sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  79  1DIQMTQSPSSLSASVGDRVTIICRASQGIRNDLTWYQQKPGKAPKELIYAASNLQSGVPSRFSGSGAGTEFTLTISSLQPEDFATYYCLQQNSYPRSFGQGTKVEIK. 107
8 -73.500sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  79  1DIQMTQSPSSLSASVGDRVTITCRASQSISSYLSWYQQKPGKAPQVLIYAASSLPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYITPTSFGQGTRVEIK. 107
9 -73.500sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  73  1DIQMTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPKILIYDASNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKLEIK. 107
10 -73.500sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  79  1DIQMTQSPSSVSASVGDRVTITCRASQDISHWLAWYQQKSGKAPKLLIYSASSLENGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQAHSVPLTFGGGTTVDIK. 107
11 -73.500sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  77  1DIQMTQSPSTLSVSVGDRVTITCEASQTVLSYLNWYQQKPGKAPKLLIYAASSLETGVPSRFSGQGSGTXFTFTISSVXPXXFATYYCQXYLDLPRTFGQGTKVDLK. 107
12 -73.500sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  73  1DIQMTQSPSSLSASVGDRVTITCQASQDIIKYLNWYQQTPGKAPKLLIYEASNLQAGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSLPYTFGQGTKLQIT. 107
13 -73.400sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  77  1DIQMTQSPSSLSASVGDRVTITCQASQDISDYLNWYQQKPGKAPKLLIYDASNLESGVPSRFSGGGSGAHFTFTISSLQPEDIATYYCQQYDYLPWTFGQGTKVEIK. 107
14 -73.400sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  77  1DIQLTQSPSSLSASVGDRVTITCRASQSVYNYVAWFQQKPGKAPKSLIYDASTLQSGVPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSYPYTFGQGTKVQIK. 107
15 -73.400sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  77  1DIQMTQSPSSLSVSVGDRVTITCQASQNVNAYLNWYQQKPGLAPKLLIYGASTREAGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYNNWPPTFGQGTKVEVK. 107
16 -73.400sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  83  1DIQMTQSPSTQPASVGDRVTITCRASQSINIWLAWYQQKPEKAPKLLIYKASTLETGVPSRFSGSGSGTEFTLTINSLQPDDFATYYCQQYSRYPYTFGQGTKLDIK. 107
17 -73.300sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  75  1XIXMTQSPSSLSASVGDRVTITCRAGQSVNKYLNWYQQKPGKAPKVLIFAASSLKSGVPSRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTTPYTFGPGTKVEMT. 107
18 -73.000sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  60  1EIVLTQSPGTLSLSPGESATLSCRASQSVSSNLAWYQQKRGQSPRLLIRDASSRANGIPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYSTSPYTFGQGTKLEIK. 107
19 -72.800sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  74  1DIQMTQSPSSLSASVGDRVTITCQASQDISIFLNWYQQKPGKAPKLLIYDASKLEAGVPSRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNLPLTFGGGTKVDFK. 107
20 -72.600sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  72  1DIQMTQSPSSLSASVGDRVTITCRASQDITNYVNWFQQRPGQAPKVLIYGASILETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDTLPLTFGGGTKVDIK. 107
21 -72.200sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  79  1DIQMTXSPSSLSASVGXRVTITCRASXTISSYLXWYXXKPGKAPXLLIYAASXLHSGVPSRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSSPTTFGXGTRLXIK. 107
22 -71.300sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  67  1DIVMTQSPDSLAVSLGERATINCKSSQSSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYSFGQGTKLEIK. 113
23 -70.600sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  67  1DIVMTQSPDSLAVSLGERATINCKSSQSNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNLPWTFGQGTKVEIK. 113
24 -70.300sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  72  1DVQMTQSPSSLSASVGDRVIITCRASQSSVDYLNWYQQKPGKAPKLLIFDTSNLQSGVPSRFSGGRSGTDFTLTISSLQPDDFATYYCQQSTNPEVTFGGGTTVDIK. 108
25 -70.200sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  84  1DIQMTQSPSTLSASVGDRVAITCRASQNISSWLAWYQQKPGKAPKVLIYKSSSLESGVPSRFSGSGSGTDFTLTISSLXPXXFATYYCQQYNTF-FTFGPGTKVDIK. 106
26 -69.700sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  52  1DIVLTQSPLSLPVTPGEPASISCRSSQSXGXYLDWYLXKPGXSPXLLIYLGSNRASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQTPLTFGGGTNVEIK. 111
27 -69.700sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  46  1SYELTQPP-SVSVSPGQTARITCSANALPNQYAYWYQQKPGRAPVMVIYKDTQRPSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNSASIFGGGTKLTVLG 107
28 -69.600sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  66  1EIVLTQSPGTLSLSPGERATLSCRASQSSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTSPRTFGQGTKVEIK. 108
29 -69.600sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  66  1EIVMTQSPATLSVSPGERATLSCRASQSVSNNLAWYQQKPGQPPRLLIYGASTRATGIPARFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNPPWTFGQGTRVEIK. 108
30 -69.500sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  68  1EIVLTQSPGTLSLSPGERATLSCRASQSSNSFLAWYQQKPGQAPRLLIYVASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVELK. 108
31 -69.400sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  67  1EIVMTQSPVTLSVSPGERATLSCRASQSSNSYLAWYQQKPSGSPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPTFGQGTRVEIK. 108
32 -69.300sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  51  1DIVMTQSPLSLPVTPGEPASISCRSSQSGFDYLNWYLQKPGQSPXLLIYALSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQAPITFGQGTRLEIK. 112
33 -69.200sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  64  1XIVLTXSPGTLSLSPGXRAALSCRASQSSGNYLAWYQQKPGQAPRLLMYGVSSRATGIPDRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSSPFTFGQGSKLEIK. 108
34 -69.200sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  67  1EIVLTQSPGTLSLSPGERATLSCRASQSSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSSPWTFGQGTKVEIK. 108
35 -69.100sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  70  1DIQMTQSPSSLSATVGDRVTLLCEASQSGNTFLAWYQQKPKKAPKLLIYDASNLETGVPSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLPSTFGVASKVESK. 111
36 -69.000sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  68  1EIVLTQSPGTLSLSPGERATLSCRASQSSNSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSSPQTFGQGSKVEIK. 108
37 -68.900sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  55  1DVVMTQSPLSLPVTLGQPASISCRSSQSGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWSWTFGQGTKVEIK. 112
38 -68.900sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  53  2DIVMTQTPLSLPVTPGEPASISCRSSQSGNTYLNWYLQKAGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEIPYTFGQGTKLEIR. 114
39 -68.800sp|P01715|LV401_HUMAN Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1  ali follow..  48  2..GLTQPP-SLSVSPGQTASITCSGDKLGEQYVCWYQQKPGQSPVLVIYHDSKRPSGIPERFSGSNSGTTATLTISGTQAMDEADYYCQAWDSYTVIFGGGTKLTVLG 106
40 -68.800sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  65  1EIVLTQSPGTLSLSPGERATLSCRAALLSRGYLAWYQQKPGQAPRLLMYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPRSFGQGTKVEIK. 108
41 -68.800sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  51  1DVVMTQSPLFLPVTLGEPASIQCRSSQSGXTYLXWYLQKPGQSPELLIYLSSYRDSGVPDRFSDSGSGTDFTLKITRVQAEDVGVYYCMQATXSPYTFGQGTKLXIK. 112
42 -68.700sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  53  5DIVMTQSPLSLPVTPGEPASISCRSSQSLYNYLDWYLQKPQQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQTPQTFGQGTKVEIK. 116
43 -68.600sp|P06889|LV405_HUMAN Ig lambda chain V-IV region MOL OS=Homo sapiens PE=1 SV=1  ali follow..  46  2..ELTQPP-SVSVSPGQTATISCSGDKLGESYYDWYQQSPGQSPLLVIYEGDKRPSGIPXRFSGSNSGNTATLTISGTESMDEADYYCQAWNSSSVLFGGGTKLTVLG 106
44 -68.400sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  66  1EIVLTQSPGTLSLSPGERATLSCRASQSSSGYLGWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSLGRTFGQGTKVEIK. 108
45 -67.900sp|P83593|KV405_HUMAN Ig kappa chain V-IV region STH (Fragment) OS=Homo sapiens PE=1 SV=1  ali follow..  65  1DIVMTQSPDSLVVSLGERATINCRSSQSNKNYLAWYQQKPGQAPKLLFSWASTRESGVPDRFSGSGSGTDFTLTIPGLQAEDVAVYYCQQYYRIPYTFGQGAK..... 109
46 -67.400sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  47  1QSVLTQPP-SLSAAPGQRVSISCSGSSSNKNYVDWYQQLPGTAPKLLIFNNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNRRSVFGGGTNVTVVG 109
47 -67.400sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  38  3FYELTQPP-SVSLAAGQTAMITCEGNDIGERSVHWYQQKPGQAPVPVIYDDADRPSGVPARFSGYNSGNSAILTINRVEAGDEADYFCQSWDNGEVVFGTGTMVTVLG 111
48 -67.100sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  41  2..ALTQPP-SVSVSPGQTAVITCSGDNLEKTFVSWFQQRPGQSPLLVIYHTSERPSEIPERFSGSSSGATATLTISGAQSVDEADYFCQTWDTITAIFGGGTKLTVLS 106
49 -66.900sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  44  2..DLTQPP-SVSVSPGQTASITCSGDKLGDKDVCWYQQRPGQSPVLVIYQDNQRSSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSMSVVFGGGTRLTVL. 105
50 -66.800sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  44  2..ELTQDP-AVSVALGQTVRITCQGDSLRGYDAAWYQQKPGQAPLLVIYGRNNRPSGIPDRFSGSSSGHTASLTITGAQAEDEADYYCNSRDSSHVLFGGGTKLTVLG 108
51 -66.700sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  66  1DIVMTQSPDSLAVSLGERATINCKSSQSNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP-TFGGGTKVEIK. 112
52 -66.400sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  38  2...VLSQPPSVSVAPGQTARITCGGDGIGGKSVHWYQQKPGQAPVLVVHEDNDRPAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRHVVFGGGTKLTVLG 108
53 -65.900sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  46  1QSALTQPR-SVSGSPGQSLTISCSGAPCDCESVSWYQQHPGKAPKLIIYGFSNRPSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADSSVIFGAGTKLTVL. 109
54 -65.600sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  48  1QSALTQPP-SASGSLGQSVTISCTGTSSGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYESDNFVFGTGTKVTVLG 111
55 -65.400sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  46  1QSALTQPR-SVSGSPGQSVTISCTGTSSAYNSVSWYQQHPGKAPKLMIFDVTKRPSGVPDRLSGSKSGDTASLTISGLRADDEADYYCCSYAGYSVIFGGGTKLTVLG 111
56 -65.400sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  45  1QSVLTQPP-SASGTPGQRVTISCFGSSSGRYYVYWYQQLPGTTPKLLIYKDNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLWVFGGGTTLTVLS 109
57 -65.400sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  47  1QSALTQPP-RVSGSPGQSVTISCTGSYSGYNHVSWYQQDPGKVPKLMIYDVDKRPSGVPDRFSGSKSANTASLTISGLQANNEADYYCSSYGGTSLIFGGGTKLTVLG 111
58 -65.400sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  43  1HSALTQPA-SVSGSLGQSITISCTGTSSGYNYVSWFQQHPGTAPKLIISEVRNRPSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYSSNSVVFGGGTKLTVLG 111
59 -65.200sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  45  1QSALTQ-PASVSGSPGQSITISCTGTTGGYDFVSWYQQHPGKAPKLLIYDVNSRPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTSRAVFGGGTKLSVLG 112
60 -65.200sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  43  1QSVLTQPP-SVSAAPGQKVTISCSGGSTNNNYVSWHQHLPGTAPKLLIYEDNKRPSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSAVVFGGGTKVTVLG 111
61 -64.900sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  49  1QSVLTQPP-SVSAAPGQKVTISCSGSSSNNDYVSWYQQVPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSGWVFGGGTKLTVLG 111
62 -64.900sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  48  1QSALTQ-PRSVSGSPGQSVTISCAGTSSGNHFVSWYQQHPGKAPKLIIYGVNKRPSGVPYRFSGSKSGNTASLTISGLQAEDEAHYYCCSYARFTWVFGGGTNLTVLG 111
63 -64.800sp|P01708|LV205_HUMAN Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  50  1QSALTQPR-SVSGSPGHSVTISCIGTSGDYKYVSWYQQHPGKAPKLIIYEVSSRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYI-GSYVFGTGTKVIVLG 109
64 -64.800sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  45  1DFMLTQ-PHSVSESPGKTVIISCTRSDGTGYYVQWYQQRPGRAPTTVIFEDTQRPSGVPDRFSGSISSNSASLTISGLQTEDEADYYCQSYDRDHWVFGGGTKLTVLG 111
65 -64.700sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  49  1QSVLTQPP-SVSAAPGQEVTISCSGSSSNDNFVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSVGMFGGGTRVTVLG 111
66 -64.300sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  40  2...VLTQPPSVSVAPGETARLTCGGNDIGSESVHWYQQKPGQAPVLVIYFDRDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQLWDSSHVVFGGGTKLTVLS 108
67 -64.300sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  50  2..SALTQPRSLSGSPGQAVTISCTGLPSDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGNYIVFGQGTDLTVLG 111
68 -64.200sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  43  1QSVLTQPP-SASGTPGQRVTISCSGGNFGRNSVNWYQVHPGTAPRLLIYSSDQRSSGVPDRFSGSKSGTSASLAISGLQSENEADYFCATWDDSGPVFGGGTKVTVLG 111
69 -63.800sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  48  1QSVLTQPP-SASGTPGGRVTISCSGSSSSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSGYVFGTGTKVTVL. 111
70 -63.700sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  44  1QSVLTQPP-SVSGTPGQRVTISCSGGSSGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRAVVFGGGTQLTVL. 111
71 -63.700sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  44  1QSALTQPP-SASGSPGQSVTISCTGTSSDNKYVSWYQQHPGRAPKLVIFEVSQRPSGVPDRFSGSKSDNTASLTVSGLRAEDEADYYCSSYDNNNFVFGGGTKLTVL. 110
72 -63.600sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  44  1QSALTQPA-SVSASPGQSITISCTGTTNSYSYVSWYQQYPGKAPKVLIFDVNSRPSGVSHRFSGSKSGNTASLTISGLQAEDEAHYFCSSYRSGTIIFGGGTYVTVL. 110
73 -63.200sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  44  1QSALTQPA-SVSGSPGQSITISCTGTTSSYNFVSWYQQNPGKAPKLMIYEGNKRPSGVSNRFSGSKSGKTASLTISGLQVEDEADYYCCSYANSTRVFGGGTRVTVLS 111
74 -63.000sp|P01602|KV110_HUMAN(removed signalp:1-22) Ig kappa chain V-I region HK102 (Fragment) OS=Homo sapiens GN=IGKV1-5 PE=4 SV=1  ali follow..  93  1DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYS............. 95
75 -62.900sp|P01601|KV109_HUMAN(removed signalp:1-22) Ig kappa chain V-I region HK101 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  86  1DIQMTQSPSSLSASVGDRVTITCRARQGISSWLAWYQQKPEKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNS............... 93

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 4 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.