current user: public

If you have questions about the server, please let us know.

Query: sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst QSVLTQPPSVSGTPGQRVTISCSGGSSNGTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRLSAVVFGGGTQLTVLRLast
1 -80.200sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali  100  1QSVLTQPPSVSGTPGQRVTISCSGGSSNGTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRLSAVVFGGGTQLTVLR 112
2 -79.500sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  77  1QSVLTQPPSASGTPGGRVTISCSGSSSNVGSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSLDGYVFGTGTKVTVLR 112
3 -76.700sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  65  1QSALTQPPSASGSPGQSVTISCTGTSSDVGDNKYVSWYQQHPGRAPKLVIFEVSQRPSGVPDRFSGSKSDNTASLTVSGLRAEDEADYYCSSYVDN-NNFVFGGGTKLTVLR 111
4 -76.600sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  62  1QSALTQPASVSGSPGQSITISCTGTTSDVGGYDFVSWYQQHPGKAPKLLIYDVNSRPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTTNSRAVFGGGTKLSVL. 111
5 -76.600sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  59  1QSALTQPASVSASPGQSITISCTGTTNDIGSYSYVSWYQQYPGKAPKVLIFDVNSRPSGVSHRFSGSKSGNTASLTISGLQAEDEAHYFCSSYRTS-GTIIFGGGTYVTVLR 111
6 -75.800sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  63  1QSALTQPRSVSGSPGQSLTISCSGAPCDVDGCESVSWYQQHPGKAPKLIIYGFSNRPSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADS--SVIFGAGTKLTVLR 110
7 -75.100sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  63  1QSALTQPASVSGSPGQSITISCTGTTSDVGSYNFVSWYQQNPGKAPKLMIYEGNKRPSGVSNRFSGSKSGKTASLTISGLQVEDEADYYCCSYAGN-STRVFGGGTRVTVLS 111
8 -75.100sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  69  1QSALTQPRSVSGSPGQSVTISCAGTSSDVGGNHFVSWYQQHPGKAPKLIIYGVNKRPSGVPYRFSGSKSGNTASLTISGLQAEDEAHYYCCSYAGR-FTWVFGGGTNLTVL. 110
9 -74.900sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  75  1QSVLTQPPSVSAAPGQKVTISCSGG-STNIGNNYVSWHQHLPGTAPKLLIYEDNKRPSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSLNAVVFGGGTKVTVL. 110
10 -74.700sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  66  1QSALTQPRSVSGSPGQSVTISCTGTSSDVGAYNSVSWYQQHPGKAPKLMIFDVTKRPSGVPDRLSGSKSGDTASLTISGLRADDEADYYCCSYAGR-YSVIFGGGTKLTVL. 110
11 -74.700sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  72  1QSVLTQPPSVSAAPGQEVTISCSGSSS-NIGDNFVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSVGMFGGGTRVTVL. 110
12 -74.700sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  65  1QSALTQPPRVSGSPGQSVTISCTGSYSNVTGYNHVSWYQQDPGKVPKLMIYDVDKRPSGVPDRFSGSKSANTASLTISGLQANNEADYYCSSYGGT-YSLIFGGGTKLTVL. 110
13 -74.600sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  63  1QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGS-DNFVFGTGTKVTVL. 110
14 -74.600sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  73  1QSVLTQPPSVSAAPGQKVTISCSGSSS-NIGNDYVSWYQQVPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSLSGWVFGGGTKLTVL. 110
15 -74.600sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  63  1HSALTQPASVSGSLGQSITISCTGTSSDVGGYNYVSWFQQHPGTAPKLIISEVRNRPSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYTSS-NSVVFGGGTKLTVL. 110
16 -74.200sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  75  1QSVLTQPPSASGTPGQRVTISCSGG-NFDIGRNSVNWYQVHPGTAPRLLIYSSDQRSSGVPDRFSGSKSGTSASLAISGLQSENEADYFCATWDDSLDGPVFGGGTKVTVL. 110
17 -73.900sp|P01708|LV205_HUMAN Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  64  1QSALTQPRSVSGSPGHSVTISCIGTSSNVGDYKYVSWYQQHPGKAPKLIIYEVSSRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYIGS---YVFGTGTKVIVL. 108
18 -72.900sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  53  3FYELTQPPSVSLAAGQTAMITCEGND---IGERSVHWYQQKPGQAPVPVIYDDADRPSGVPARFSGYNSGNSAILTINRVEAGDEADYFCQSWDNGSYEVVFGTGTMVTVL. 110
19 -72.600sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  60  1ASALTQPRSLSGSPGQAVTISCTGLPSVVDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGN-YIFVFGQGTDLTVL. 110
20 -72.000sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  56  1.SELTQDPAVSVALGQTVRITCQGDS---LRGYDAAWYQQKPGQAPLLVIYGRNNRPSGIPDRFSGSSSGHTASLTITGAQAEDEADYYCNSRDSSGKHVLFGGGTKLTVL. 107
21 -72.000sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  81  1QSVLTQPPSASGTPGQRVTISCFGS-SSNIGRYYVYWYQQLPGTTPKLLIYKDNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDS--LWVFGGGTTLTVLS 109
22 -71.200sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  72  1QSVLTQPPSLSAAPGQRVSISCSGSSS-NIGKNYVDWYQQLPGTAPKLLIFNNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNR--RSVFGGGTNVTVV. 108
23 -70.100sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  56  2..VLSQPPSVSVAPGQTARITCGGDG---IGGKSVHWYQQKPGQAPVLVVHEDNDRPAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRTAHVVFGGGTKLTVL. 107
24 -69.200sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  57  2..VLTQPPSVSVAPGETARLTCGGND---IGSESVHWYQQKPGQAPVLVIYFDRDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQLWDSSSEHVVFGGGTKLTVLS 108
25 -68.700sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  49  1DIVMTQSPSLAVSLGERATINCKSSQSSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP---TFGGGTKVEIKR 113
26 -68.500sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  45  1DVQMTQSPSLSASVGDRVIITCRASQS---SVDYLNWYQQKPGKAPKLLIFDTSNLQSGVPSRFSGGRSGTDFTLTISSLQPDDFATYYCQQSYTN-PEVTFGGGTTVDIKR 109
27 -68.300sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  45  1EIVMTQSPTLSVSPGERATLSCRASQS--ISNSYLAWYQQKPSGSPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNW--PPTFGQGTRVEIKR 109
28 -68.200sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  55  2..ALTQPPSVSVSPGQTAVITCSGDNL---EKTFVSWFQQRPGQSPLLVIYHTSERPSEIPERFSGSSSGATATLTISGAQSVDEADYFCQTWDTI--TAIFGGGTKLTVLS 106
29 -68.200sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  45  1EIVMTQSPTLSVSPGERATLSCRASQS---VSNNLAWYQQKPGQPPRLLIYGASTRATGIPARFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNW-PPWTFGQGTRVEIKR 109
30 -68.000sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  47  1EIVLTQSPTLSLSPGERATLSCRASQS--VSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTS--PRTFGQGTKVEIKR 109
31 -68.000sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  45  1DIVLTQSPSLPVTPGEPASISCRSSQNLXSXGXYLDWYLXKPGXSPXLLIYLGSNRASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQT--PLTFGGGTNVEIKR 112
32 -67.900sp|P01703|LV105_HUMAN Ig lambda chain V-I region NEWM OS=Homo sapiens PE=1 SV=1  ali follow..  70  1QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGNHVKWYQQLPGTAPKLLIFHNN-------ARFSVSKSGSSATLAITGLQAEDEADYYCQSYDRS--LRVFGGGTKLTVLR 103
33 -67.800sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  60  2..DLTQPPSVSVSPGQTASITCSGDKL---GDKDVCWYQQRPGQSPVLVIYQDNQRSSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSM--SVVFGGGTRLTVLS 106
34 -67.800sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  46  1XIVLTXSPTLSLSPGXRAALSCRASQS--LSGNYLAWYQQKPGQAPRLLMYGVSSRATGIPDRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSS--PFTFGQGSKLEIK. 108
35 -67.700sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  44  1DIQMTQSPSLSATVGDRVTLLCEASQSVESGNTFLAWYQQKPKKAPKLLIYDASNLETGVPSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLPS--TFGVASKVESKR 112
36 -67.700sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  43  1DIQMTQSPTLSASVGDRVAITCRASQN---ISSWLAWYQQKPGKAPKVLIYKSSSLESGVPSRFSGSGSGTDFTLTISSLXPXXFATYYCQQYNTF---FTFGPGTKVDIKR 107
37 -67.600sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  48  1DIVMTQSPSLAVSLGERATINCKSSQSSSNSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYST--PYSFGQGTKLEIKR 114
38 -67.600sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  47  1EIVLTQSPTLSLSPGERATLSCRASQS--VSNSFLAWYQQKPGQAPRLLIYVASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSS--PSTFGQGTKVELKR 109
39 -67.500sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  45  1DIVMTQSPSLPVTPGEPASISCRSSQSHSDGFDYLNWYLQKPGQSPXLLIYALSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQA--PITFGQGTRLEIKR 113
40 -67.400sp|P01722|LV602_HUMAN Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1  ali follow..  54  1NLMLIQPPSVSESPGKTVTMSCTRT-SDSIASNYVQWYRQRPGGAPTTLIYDTNQRPYGVPNRFSGSFSSNSASLTISGLTNDDTAMYFCQSYDSS-NLWVFGGGTKLTVLS 112
41 -67.400sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  46  1EIVLTQSPTLSLSPGERATLSCRASQS--VSNSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSS--PQTFGQGSKVEIKR 109
42 -67.200sp|P04211|LV001_HUMAN(removed signalp:1-20) Ig lambda chain V region 4A OS=Homo sapiens PE=4 SV=1  ali follow..  42  1QTVVTQEPSLTVSPGGTVTLTCASSTGAVTSGYYPNWFQQKPGQAPRALIYSTSNKHSWTPARFSGSLLGGKAALTLSGVQPEDEAEYYCLLYYGGA............... 97
43 -67.100sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  45  1EIVLTQSPTLSLSPGERATLSCRAAL--LSSRGYLAWYQQKPGQAPRLLMYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSS--PRSFGQGTKVEIKR 109
44 -67.100sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  47  1EIVLTQSPTLSLSPGERATLSCRASQS--VSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSS--PWTFGQGTKVEIKR 109
45 -67.000sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  47  1DIQLTQSPSLSASVGDRVTITCRASQS---VYNYVAWFQQKPGKAPKSLIYDASTLQSGVPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSY--PYTFGQGTKVQIKR 108
46 -67.000sp|P01721|LV601_HUMAN Ig lambda chain V-VI region AR OS=Homo sapiens PE=1 SV=1  ali follow..  55  1DFMLTQPHSVSESPGKTVTFSCTGS-GGSIADSFVQWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSISANSASLTISGLKTEDEADYYCQSYNSNHHV-VFGGGTKVTVL. 111
47 -67.000sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  44  1DVVMTQSPSLPVTLGQPASISCRSSQSYSDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHW--SWTFGQGTKVEIKR 113
48 -67.000sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  47  1DIVMTQSPSLAVSLGERATINCKSSQSSSDNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNL--PWTFGQGTKVEIKR 114
49 -66.900sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  47  1DIQMTQSPSLSASVGDRVTITCRASQS---ISSYLSWYQQKPGKAPQVLIYAASSLPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYIT--PTSFGQGTRVEIKR 108
50 -66.900sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  44  5DIVMTQSPSLPVTPGEPASISCRSSQSHSNGYNYLDWYLQKPQQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQT--PQTFGQGTKVEIKR 117
51 -66.800sp|P06319|LV605_HUMAN(removed signalp:1-19) Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1  ali follow..  58  1NFMLTQPHSVSESPGKTVTISCTGN-SGSIASNYVQWYQQRRVSAPTIVIYEDNQRPLGVPDRFSGSISSNSASLTISGLKTEDEADYYCQSFDNT-NQGVFGGGTKLTVL. 111
52 -66.800sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  44  1EIVLTQSPTLSLSPGESATLSCRASQS---VSSNLAWYQQKRGQSPRLLIRDASSRANGIPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYSTS--PYTFGQGTKLEIKR 108
53 -66.700sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQMTQSPSLSASVGDRVTITCQASQD---ISIFLNWYQQKPGKAPKLLIYDASKLEAGVPSRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNL--PLTFGGGTKVDFKR 108
54 -66.700sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQMTQSPSLSASVGDRVTITCQASQD---ISDYLNWYQQKPGKAPKLLIYDASNLESGVPSRFSGGGSGAHFTFTISSLQPEDIATYYCQQYDYL--PWTFGQGTKVEIKR 108
55 -66.600sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  57  1DFMLTQPHSVSESPGKTVIISCTRS-DGTIAGYYVQWYQQRPGRAPTTVIFEDTQRPSGVPDRFSGSISSNSASLTISGLQTEDEADYYCQSYDRD--HWVFGGGTKLTVL. 110
56 -66.600sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQMTQSPSLSASVGDRVTITCQASQD---INHYLNWYQQGPKKAPKILIYDASNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTL--PRTFGQGTKLEIKR 108
57 -66.600sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  46  2DIVMTQTPSLPVTPGEPASISCRSSQSSGDGNTYLNWYLQKAGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEI--PYTFGQGTKLEIRR 115
58 -66.600sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  47  1EIVLTQSPTLSLSPGERATLSCRASQS--VSSGYLGWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSL--GRTFGQGTKVEIKR 109
59 -66.600sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  42  1DVVMTQSPFLPVTLGEPASIQCRSSQSLVYGXTYLXWYLQKPGQSPELLIYLSSYRDSGVPDRFSDSGSGTDFTLKITRVQAEDVGVYYCMQATXS--PYTFGQGTKLXIKR 113
60 -66.600sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  43  1DIQMTQSPPLSASVGDSVTITCQASQD---IRNSLIWYQQKPGKAPKFLIYDAENLEIGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNL--PYTFGQGTKLEIKR 108
61 -66.500sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  59  1SYELTQPPSVSVSPGQTARITCSANAL---PNQYAYWYQQKPGRAPVMVIYKDTQRPSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNS--ASIFGGGTKLTVL. 106
62 -66.500sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  45  1DIQMTQSPSLSASVGDRVTITCRAGHN---ITNFLSWYQQKPGKAPTLLIYAVSNLQVGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNF--SFTFGGGTKVDNK. 107
63 -66.500sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  48  1DIQMTQSPSLSASVGDRVTITCRASQS---ISNYLNWYQQKPGKAPKLLIYAASSLQSGVTSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYST--LITFGQGTRLEIK. 107
64 -66.400sp|P06318|LV604_HUMAN Ig lambda chain V-VI region WLT OS=Homo sapiens PE=1 SV=1  ali follow..  59  1NFMLTQPLSVSGSPEKTVTISCTGS-SGSIGSNYVQWYQQRPGSAPTNVIYENNQRPSEVPDRFSGSISSNSASLTISGLKTEDEADYYCQSYDNNNH--VVFGGTRLTVL. 110
65 -66.400sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  48  1DIQMTXSPSLSASVGXRVTITCRASXT---ISSYLXWYXXKPGKAPXLLIYAASXLHSGVPSRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSS--PTTFGXGTRLXIKR 108
66 -66.400sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  50  1XIXMTQSPSLSASVGDRVTITCRAGQS---VNKYLNWYQQKPGKAPKVLIFAASSLKSGVPSRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTT--PYTFGPGTKVEMTR 108
67 -66.300sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  43  1DIQMTQSPTQPASVGDRVTITCRASQS---INIWLAWYQQKPEKAPKLLIYKASTLETGVPSRFSGSGSGTEFTLTINSLQPDDFATYYCQQYSRY--PYTFGQGTKLDIKR 108
68 -66.300sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  45  1DIQMTQSPSLSASVGDRVTIICRASQG---IRNDLTWYQQKPGKAPKELIYAASNLQSGVPSRFSGSGAGTEFTLTISSLQPEDFATYYCLQQNSY--PRSFGQGTKVEIKR 108
69 -66.200sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  48  1DIQMTQSPSLSVSVGDRVTITCQASQN---VNAYLNWYQQKPGLAPKLLIYGASTREAGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYNNW--PPTFGQGTKVEVKR 108
70 -66.200sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  47  1DIQMTQSPSLSASVGDRVTITCRASQD---ITNYVNWFQQRPGQAPKVLIYGASILETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDTL--PLTFGGGTKVDIKR 108
71 -66.200sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  47  1DIQMTQSPSLSASVGDRVTITCRASQG---IRNDLTWYQQKPGTAPKRLIYGATSLQSGVPSRFSGSGSGTEFTLTINSLQPEDFATYYCLQYSSF--PWTFGQGTKVEVKR 108
72 -66.000sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQMTQSPSLSASVGDRVTITCQASQD---IIKYLNWYQQTPGKAPKLLIYEASNLQAGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSL--PYTFGQGTKLQITR 108
73 -65.800sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQMTQSPSVSASVGDRVTITCRASQD---ISHWLAWYQQKSGKAPKLLIYSASSLENGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQAHSV--PLTFGGGTTVDIKR 108
74 -65.600sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  42  1DIQMTQSPTLSVSVGDRVTITCEASQT---VLSYLNWYQQKPGKAPKLLIYAASSLETGVPSRFSGQGSGTXFTFTISSVXPXXFATYYCQXYLDL--PRTFGQGTKVDLKR 108
75 -65.400sp|P01715|LV401_HUMAN Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1  ali follow..  62  2..GLTQPPSLSVSPGQTASITCSGDKL---GEQYVCWYQQKPGQSPVLVIYHDSKRPSGIPERFSGSNSGTTATLTISGTQAMDEADYYCQAWDSY--TVIFGGGTKLTVL. 105

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35