current user: public

If you have questions about the server, please let us know.

Query: sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst QSVLTQPPSVSAAPGQKVTISCSGGSTNIGNNYVSWHQHLPGTAPKLLIYEDNKRPSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSLNAVVFGGGTKVTVLGLast
1 -80.100sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali  100  1QSVLTQPPSVSAAPGQKVTISCSGGSTNIGNNYVSWHQHLPGTAPKLLIYEDNKRPSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSLNAVVFGGGTKVTVLG 111
2 -79.800sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  83  1QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQVPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSLSGWVFGGGTKLTVLG 111
3 -79.700sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  83  1QSVLTQPPSVSAAPGQEVTISCSGSSSNIGDNFVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSVGMFGGGTRVTVLG 111
4 -79.700sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  69  1QSVLTQPPSASGTPGQRVTISCSGGNFDIGRNSVNWYQVHPGTAPRLLIYSSDQRSSGVPDRFSGSKSGTSASLAISGLQSENEADYFCATWDDSLDGPVFGGGTKVTVLG 111
5 -76.000sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  58  1QSALTQPASVSGSPGQSITISCTGTTSDVGYDFVSWYQQHPGKAPKLLIYDVNSRPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTTNSRAVFGGGTKLSVLG 112
6 -75.900sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  78  1QSVLTQPPSLSAAPGQRVSISCSGSSSNIGKNYVDWYQQLPGTAPKLLIFNNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNR--RSVFGGGTNVTVVG 109
7 -75.100sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  70  1QSVLTQPPSASGTPGGRVTISCSGSSSNVSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSLDGYVFGTGTKVTVL. 111
8 -74.900sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  54  3FYELTQPPSVSLAAGQTAMITCEGND--IGERSVHWYQQKPGQAPVPVIYDDADRPSGVPARFSGYNSGNSAILTINRVEAGDEADYFCQSWDNGSYEVVFGTGTMVTVLG 111
9 -74.900sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  75  1QSVLTQPPSVSGTPGQRVTISCSGGSSGTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRLSAVVFGGGTQLTVL. 111
10 -74.200sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  58  1.SELTQDPAVSVALGQTVRITCQGDS--LRGYDAAWYQQKPGQAPLLVIYGRNNRPSGIPDRFSGSSSGHTASLTITGAQAEDEADYYCNSRDSSGKHVLFGGGTKLTVLG 108
11 -74.200sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  72  1QSVLTQPPSASGTPGQRVTISCFGSSSNIGRYYVYWYQQLPGTTPKLLIYKDNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDS--LWVFGGGTTLTVLS 109
12 -74.100sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  61  1QSALTQPRSVSGSPGQSVTISCTGTSSDVAYNSVSWYQQHPGKAPKLMIFDVTKRPSGVPDRLSGSKSGDTASLTISGLRADDEADYYCCSYAGR-YSVIFGGGTKLTVLG 111
13 -74.100sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  62  1QSALTQPPSASGSLGQSVTISCTGTSSDVGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGS-DNFVFGTGTKVTVLG 111
14 -73.900sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  58  1QSALTQPPRVSGSPGQSVTISCTGSYSNVGYNHVSWYQQDPGKVPKLMIYDVDKRPSGVPDRFSGSKSANTASLTISGLQANNEADYYCSSYGGT-YSLIFGGGTKLTVLG 111
15 -73.900sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  62  1HSALTQPASVSGSLGQSITISCTGTSSDVGYNYVSWFQQHPGTAPKLIISEVRNRPSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYTSS-NSVVFGGGTKLTVLG 111
16 -73.500sp|P01708|LV205_HUMAN Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  62  1QSALTQPRSVSGSPGHSVTISCIGTSSNVDYKYVSWYQQHPGKAPKLIIYEVSSRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYIGS---YVFGTGTKVIVLG 109
17 -73.500sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  60  1QSALTQPRSVSGSPGQSVTISCAGTSSVGGNHFVSWYQQHPGKAPKLIIYGVNKRPSGVPYRFSGSKSGNTASLTISGLQAEDEAHYYCCSYAGR-FTWVFGGGTNLTVLG 111
18 -72.900sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  60  1QSALTQPPSASGSPGQSVTISCTGTSSDVDNKYVSWYQQHPGRAPKLVIFEVSQRPSGVPDRFSGSKSDNTASLTVSGLRAEDEADYYCSSYVDN-NNFVFGGGTKLTVL. 110
19 -72.800sp|P06319|LV605_HUMAN(removed signalp:1-19) Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1  ali follow..  58  1NFMLTQPHSVSESPGKTVTISCTGNSGSIASNYVQWYQQRRVSAPTIVIYEDNQRPLGVPDRFSGSISSNSASLTISGLKTEDEADYYCQSFDNT-NQGVFGGGTKLTVLG 112
20 -72.800sp|P01721|LV601_HUMAN Ig lambda chain V-VI region AR OS=Homo sapiens PE=1 SV=1  ali follow..  57  1DFMLTQPHSVSESPGKTVTFSCTGSGGSIADSFVQWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSISANSASLTISGLKTEDEADYYCQSYNSN-HHVVFGGGTKVTVLG 112
21 -72.700sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  56  1QSALTQPASVSASPGQSITISCTGTTNDISYSYVSWYQQYPGKAPKVLIFDVNSRPSGVSHRFSGSKSGNTASLTISGLQAEDEAHYFCSSYRTS-GTIIFGGGTYVTVL. 110
22 -72.400sp|P06318|LV604_HUMAN Ig lambda chain V-VI region WLT OS=Homo sapiens PE=1 SV=1  ali follow..  55  1NFMLTQPLSVSGSPEKTVTISCTGSSGSIGSNYVQWYQQRPGSAPTNVIYENNQRPSEVPDRFSGSISSNSASLTISGLKTEDEADYYCQSYDNNNH--VVFGGTRLTVLG 111
23 -72.300sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  54  1DFMLTQPHSVSESPGKTVIISCTRSDGTIAGYYVQWYQQRPGRAPTTVIFEDTQRPSGVPDRFSGSISSNSASLTISGLQTEDEADYYCQSYDRD--HWVFGGGTKLTVLG 111
24 -72.200sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  58  1QSALTQPASVSGSPGQSITISCTGTTSDVSYNFVSWYQQNPGKAPKLMIYEGNKRPSGVSNRFSGSKSGKTASLTISGLQVEDEADYYCCSYAGN-STRVFGGGTRVTVLS 111
25 -71.800sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  57  2..VLSQPPSVSVAPGQTARITCGGDGI--GGKSVHWYQQKPGQAPVLVVHEDNDRPAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRTAHVVFGGGTKLTVLG 108
26 -71.100sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  54  1ASALTQPRSLSGSPGQAVTISCTGLPSVDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGN-YIFVFGQGTDLTVLG 111
27 -71.000sp|P01722|LV602_HUMAN Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1  ali follow..  53  1NLMLIQPPSVSESPGKTVTMSCTRTSDSIASNYVQWYRQRPGGAPTTLIYDTNQRPYGVPNRFSGSFSSNSASLTISGLTNDDTAMYFCQSYDSS-NLWVFGGGTKLTVLS 112
28 -70.900sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  58  1QSALTQPRSVSGSPGQSLTISCSGAPCDVGCESVSWYQQHPGKAPKLIIYGFSNRPSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADS--SVIFGAGTKLTVL. 109
29 -69.200sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  59  2..VLTQPPSVSVAPGETARLTCGGNDI--GSESVHWYQQKPGQAPVLVIYFDRDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQLWDSSSEHVVFGGGTKLTVLS 108
30 -68.500sp|P01825|HV207_HUMAN Ig heavy chain V-II region NEWM OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QVQLEQSGPGLVRPSQTLSLTCTVSGSTFSNDYYTWVRQPPGRGLEWIGYVTSDDTTPLRSRVTMLVSKNQFSLRLSSVTAADTAVYYCARNLIAGCIDVWGQGSLVTVSS 117
31 -68.200sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  57  1SYELTQPPSVSVSPGQTARITCSANAL--PNQYAYWYQQKPGRAPVMVIYKDTQRPSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNS--ASIFGGGTKLTVLG 107
32 -67.900sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  43  1XIVLTXSPTLSLSPGXRAALSCRASQ-SLSGNYLAWYQQKPGQAPRLLMYGVSSRATGIPDRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSS--PFTFGQGSKLEIK. 108
33 -67.700sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  55  2..ALTQPPSVSVSPGQTAVITCSGDNL--EKTFVSWFQQRPGQSPLLVIYHTSERPSEIPERFSGSSSGATATLTISGAQSVDEADYFCQTWDTI--TAIFGGGTKLTVLS 106
34 -67.500sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  44  1DIVMTQSPSLAVSLGERATINCKSSQSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP---TFGGGTKVEIK. 112
35 -67.500sp|P01780|HV319_HUMAN Ig heavy chain V-III region JON OS=Homo sapiens PE=1 SV=1  ali follow..  22  1DVQLVESGGGLVKPGGSLRLSCAASGFTFSTAWMKWVRQAPGKGLEWVVWREKAFANSVNGRFTISRSKNTLYLQMISVTPXXTAVYYCARVVVSTSMDVWGQGTPVT... 115
36 -67.400sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  41  1EIVMTQSPTLSVSPGERATLSCRASQ-SISNSYLAWYQQKPSGSPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNW--PPTFGQGTRVEIK. 108
37 -67.100sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  45  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTS--PRTFGQGTKVEIK. 108
38 -66.900sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  40  1EIVMTQSPTLSVSPGERATLSCRASQS--VSNNLAWYQQKPGQPPRLLIYGASTRATGIPARFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNW-PPWTFGQGTRVEIK. 108
39 -66.800sp|P80419|HV322_HUMAN Ig heavy chain V-III region GAR OS=Homo sapiens PE=1 SV=1  ali follow..  20  1EVQLVESGGGLVQPGESLKLSCTASGFSYSNYVMTWVRQAPGKGLEWVTNIRPDYSDSVRFTVSRDNARNSVSNSMFLQRVEDTATYYCARVSDDYGPDFWGQGTLVSVTS 118
40 -66.800sp|P01772|HV311_HUMAN Ig heavy chain V-III region KOL OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QVQLVESGGGVVQPGRSLRLSCSSSGFIFSSYAMYWVRQAPGKGLEWVAIIDQHYADSVKGRFTISRSKNTLFLQMDSLRPEDTGVYFCARDGGHGFCDYWGQGTPVTVSS 126
41 -66.800sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  46  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSNSFLAWYQQKPGQAPRLLIYVASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSS--PSTFGQGTKVELK. 108
42 -66.800sp|P06326|HV107_HUMAN Ig heavy chain V-I region Mot OS=Homo sapiens PE=1 SV=1  ali follow..  22  1QVQLVQSGAEVKKPGSSARLSCKVSGDDFNTYDIHWVRQAPGRGLEWMAVVRTTYGPRSQARFTVTRSTTTVYMELTALISADTAIYYCARGAHYSDTDPWGQGTLLIVSS 125
43 -66.700sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  40  1DIQMTQSPSLSATVGDRVTLLCEASQSESGNTFLAWYQQKPKKAPKLLIYDASNLETGVPSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLPS--TFGVASKVESK. 111
44 -66.700sp|P06331|HV209_HUMAN(removed signalp:1-20) Ig heavy chain V-II region ARH-77 OS=Homo sapiens PE=4 SV=1  ali follow..  24  1QVQLQQWGAGLVKPSETLSLTCAVFGGSFSGYYWSWIRQPPGRGLEWIGEISTNYKTSLKSRVTISLSKNLFSLKLSSVTAADTAVYYCARGLLRGGWDVWGQGTTVTVSS 126
45 -66.700sp|P01715|LV401_HUMAN Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1  ali follow..  61  2..GLTQPPSLSVSPGQTASITCSGDKL--GEQYVCWYQQKPGQSPVLVIYHDSKRPSGIPERFSGSNSGTTATLTISGTQAMDEADYYCQAWDSY--TVIFGGGTKLTVLG 106
46 -66.600sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  41  1DVQMTQSPSLSASVGDRVIITCRASQS--SVDYLNWYQQKPGKAPKLLIFDTSNLQSGVPSRFSGGRSGTDFTLTISSLQPDDFATYYCQQSYTN-PEVTFGGGTTVDIK. 108
47 -66.400sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  46  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSNSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSS--PQTFGQGSKVEIK. 108
48 -66.200sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  59  2..DLTQPPSVSVSPGQTASITCSGDKL--GDKDVCWYQQRPGQSPVLVIYQDNQRSSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSM--SVVFGGGTRLTVL. 105
49 -66.200sp|P01770|HV309_HUMAN Ig heavy chain V-III region NIE OS=Homo sapiens PE=1 SV=1  ali follow..  25  1QVQLVQSGGGVVQPGRSLRLSCAASGFTFSRYTIHWVRQAPGKGLEWVAVMSYXYADSVNGRFTISRSKNTLYLNMNSLRPEDTAVYYCARIRDTAMFFHWGQGTLVTVSS 119
50 -66.100sp|P06889|LV405_HUMAN Ig lambda chain V-IV region MOL OS=Homo sapiens PE=1 SV=1  ali follow..  63  2..ELTQPPSVSVSPGQTATISCSGDKL--GESYYDWYQQSPGQSPLLVIYEGDKRPSGIPXRFSGSNSGNTATLTISGTESMDEADYYCQAWNSS--SVLFGGGTKLTVLG 106
51 -66.100sp|P01816|HV203_HUMAN Ig heavy chain V-II region DAW OS=Homo sapiens PE=1 SV=1  ali follow..  27  1QVTLRESGPALVRPTQTLTLTCTFSGFSLETMCVAWIRQPPGEALEWLAWDDKYYGASLETRLAVSKSKNQVVLSMNTVGPGDTATYYCARSCGSQYFDYWGQGILVTVSS 119
52 -66.100sp|P01782|HV321_HUMAN Ig heavy chain V-III region DOB OS=Homo sapiens PE=1 SV=1  ali follow..  24  1EVQLVESGGDLVQPGRSLRLSCAASGFNFHEYNMHWLRQGPGKGPEWVSTITWNYADSVKGRFAISRAQKTLYLQLNILRPEDTAFYYCAKGYIWNGNDSWGQGTLVTVSS 120
53 -66.100sp|P01768|HV307_HUMAN Ig heavy chain V-III region CAM OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QVELVESGGGVVXPGRSLRLSCAASGFTFSNYAMHWVRQPPGKGLEWVAVISYXYAXSVKGRFTISRSKXTLYLQMNSLRAEXTAVYYCARDRPLYGXNYWGQGTLVTVSS 122
54 -66.000sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  45  1EIVLTQSPTLSLSPGERATLSCRAALLS-SRGYLAWYQQKPGQAPRLLMYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSS--PRSFGQGTKVEIK. 108
55 -66.000sp|P01771|HV310_HUMAN Ig heavy chain V-III region HIL OS=Homo sapiens PE=1 SV=1  ali follow..  27  1QVKLVQAGGGVVQPGRSLRLSCIASGFTFSNYGMHWVRQAPGKGLEWVAVIRTYYGDSVKGRFTISRSKRTLYMXMNSLRTEDTAVYYCARDPDILTADYWGQGVLVTVSS 121
56 -65.900sp|P01760|HV105_HUMAN Ig heavy chain V-I region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  27  1QVQLMQSGAEVKKPGSSVRVSCKTSGGTFVDYKGLWVRQAPGKGLEWVGQIGEVKNPGSVVRVSVSLSFNQAHMELSSLFSEDTAVYYCAREYGFDTSYYWGQGTLVTVSS 122
57 -65.900sp|P01744|HV104_HUMAN(removed signalp:1-19) Ig heavy chain V-I region ND (Fragments) OS=Homo sapiens PE=1 SV=2  ali follow..  27  1QTQLVQSGAEVRKPGASVRVSCKASGYTFIDSYIHWIRQAPGHGLEWVGWIGTNYAPRFQGRVTMTRSFSTAYMDLRSLRSDDSAVFYCAKSDPFWSDYVWGQGTTVTVSS 128
58 -65.900sp|P01769|HV308_HUMAN Ig heavy chain V-III region GA OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QVXLVXSGGGAVXPGRSLRLSCAASGFSFSTYAMHWVRQAPGKGLXWLSVISYXYAASVKGRFTISRSKXTMYLEMNSLRAENTAVYYCARSGIALGSDYWGXGTLVTISS 122
59 -65.900sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  40  1DIQMTQSPTLSASVGDRVAITCRASQNI--SSWLAWYQQKPGKAPKVLIYKSSSLESGVPSRFSGSGSGTDFTLTISSLXPXXFATYYCQQYNTF---FTFGPGTKVDIK. 106
60 -65.800sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  46  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSS--PWTFGQGTKVEIK. 108
61 -65.700sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  41  1DIVLTQSPSLPVTPGEPASISCRSSQNLLXGXYLDWYLXKPGXSPXLLIYLGSNRASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQT--PLTFGGGTNVEIK. 111
62 -65.700sp|P01761|HV106_HUMAN Ig heavy chain V-I region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QVQLVQSGAEVKKPGSSVRVTCKTSGGTFSGYTISWVRQAPGRGLEWVGSPAKQGVYIKWERVTVSLSFNQAYMELVNLFNEDGAVYYCAREWKGQVNDYWGQGVLVTVSS 122
63 -65.700sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  42  1DIVMTQSPSLAVSLGERATINCKSSQSVLSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYST--PYSFGQGTKLEIK. 113
64 -65.700sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  43  1DIQLTQSPSLSASVGDRVTITCRASQSV--YNYVAWFQQKPGKAPKSLIYDASTLQSGVPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSY--PYTFGQGTKVQIK. 107
65 -65.600sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  45  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSSGYLGWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSL--GRTFGQGTKVEIK. 108
66 -65.500sp|P01773|HV312_HUMAN Ig heavy chain V-III region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  25  1QVQLVESGGGVVQAGTSLRLSCTASAFNLSDYAMHWVRQAPGKGLXWVALSXTYYADSVRGRFTISRSKXTLYLXMKTLRTEDTAVYYCAKLIAVAGTRFWGQGTLVTVS. 118
67 -65.500sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  43  1DIQMTQSPSLSASVGDRVTITCRAGHNI--TNFLSWYQQKPGKAPTLLIYAVSNLQVGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNF--SFTFGGGTKVDNK. 107
68 -65.500sp|P01742|HV101_HUMAN Ig heavy chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  22  1QVQLVQSGAEVKKPGSSVKVSCKASGGTFSRSAIIWVRQAPGQGLEWMGGIPPNYAQKFQGRVTITASTNTAYMELSSLRSEDTAFYFCAGGYGIYSP-EEYNGGLVTVSS 117
69 -65.500sp|P01762|HV301_HUMAN Ig heavy chain V-III region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  27  1QVQLVQSGGGLVKPGGSLRLSCVASGFSFRDFYMSWIRXTPGKGLXWVSYITLYYADSVKGRFTISRAQKSLYLXMXSLRTXXTAVYYCAATXXFXWSXYWGXGXLVTVSS 122
70 -65.500sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  42  1DIQMTQSPSLSASVGDRVTITCRASQSI--SNYLNWYQQKPGKAPKLLIYAASSLQSGVTSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYST--LITFGQGTRLEIK. 107
71 -65.400sp|P01767|HV306_HUMAN Ig heavy chain V-III region BUT OS=Homo sapiens PE=1 SV=1  ali follow..  27  1EVQLVETGGGLIQPGGSLRLSCAASGFTVSXHSMSWVRQAPGKALXWVSAIYRGYADSVKGRFTISRSRXTVYLQMXSLRAEDTAVYYCARDLAA--ARLFGKGTTVTVSS 115
72 -65.300sp|P01781|HV320_HUMAN Ig heavy chain V-III region GAL OS=Homo sapiens PE=1 SV=1  ali follow..  24  1EVQLVESGGDLVQPGRSLRLSCAASGFXFXXLGMTWVRQAPGKGLEWVANIKXXYVDSVKGRFTISRAKNSLYLQMNSLRVEDTALYYCARGWGGGD--YWGQGTLVTVST 116
73 -65.200sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1  ali follow..  23  1EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYVMSWVRQAPGKGLXWVGAISXSYAXSVKGRFTISRD--DSKNTMNSLRAEDTAVYYCAKGKVSAYYFYWGXGTLVTVSS 115
74 -65.200sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  42  1DIVMTQSPSLAVSLGERATINCKSSQSILNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNL--PWTFGQGTKVEIK. 113
75 -65.200sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  43  1DIQMTQSPTLSASVGDRVTITCRASQSI--NTWLAWYQQKPGKAPKLLMYKASSLESGVPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSD--SKMFGQGTKVEVKG 108

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.