current user: public

If you have questions about the server, please let us know.

Query: sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst YVLSQPPSVSVAPGQTARITCGGDGIGGKSVHWYQQKPGQAPVLVVHEDNDRPAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRTAHVVFGGGTKLTVLGLast
1 -76.700sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali  100  1YVLSQPPSVSVAPGQTARITCGGDGIGGKSVHWYQQKPGQAPVLVVHEDNDRPAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRTAHVVFGGGTKLTVLG 108
2 -74.100sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  81  1YVLTQPPSVSVAPGETARLTCGGNDIGSESVHWYQQKPGQAPVLVIYFDRDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQLWDSSSEHVVFGGGTKLTVLS 108
3 -74.000sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  69  5.ELTQPPSVSLAAGQTAMITCEGNDIGERSVHWYQQKPGQAPVPVIYDDADRPSGVPARFSGYNSGNSAILTINRVEAGDEADYFCQSWDNGSYEVVFGTGTMVTVLG 111
4 -74.000sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  64  2.ELTQDPAVSVALGQTVRITCQGDSLRGYDAAWYQQKPGQAPLLVIYGRNNRPSGIPDRFSGSSSGHTASLTITGAQAEDEADYYCNSRDSSGKHVLFGGGTKLTVLG 108
5 -71.900sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  57  3.ALTQPASVSGSPGQSITISCTGTTGGYDFVSWYQQHPGKAPKLLIYDVNSRPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTTNSRAVFGGGTKLSVLG 112
6 -71.800sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  57  3.VLTQPPSVSAAPGQKVTISCSGGSTGNNYVSWHQHLPGTAPKLLIYEDNKRPSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSLNAVVFGGGTKVTVLG 111
7 -71.700sp|P01715|LV401_HUMAN Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1  ali follow..  70  1YGLTQPPSLSVSPGQTASITCSGDKLGEQYVCWYQQKPGQSPVLVIYHDSKRPSGIPERFSGSNSGTTATLTISGTQAMDEADYYCQAWDSY--TVIFGGGTKLTVLG 106
8 -71.500sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  58  3.VLTQPPSVSAAPGQKVTISCSGSSSGNDYVSWYQQVPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSLSGWVFGGGTKLTVLG 111
9 -71.300sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  57  3.VLTQPPSVSAAPGQEVTISCSGSSSGDNFVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSVGMFGGGTRVTVLG 111
10 -71.000sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  61  1YALTQPPSVSVSPGQTAVITCSGDNLEKTFVSWFQQRPGQSPLLVIYHTSERPSEIPERFSGSSSGATATLTISGAQSVDEADYFCQTWDTI--TAIFGGGTKLTVLS 106
11 -70.800sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  54  3.VLTQPPSASGTPGQRVTISCSGGNIGRNSVNWYQVHPGTAPRLLIYSSDQRSSGVPDRFSGSKSGTSASLAISGLQSENEADYFCATWDDSLDGPVFGGGTKVTVLG 111
12 -70.700sp|P06889|LV405_HUMAN Ig lambda chain V-IV region MOL OS=Homo sapiens PE=1 SV=1  ali follow..  67  1YELTQPPSVSVSPGQTATISCSGDKLGESYYDWYQQSPGQSPLLVIYEGDKRPSGIPXRFSGSNSGNTATLTISGTESMDEADYYCQAWNSS--SVLFGGGTKLTVLG 106
13 -70.600sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  72  1YDLTQPPSVSVSPGQTASITCSGDKLGDKDVCWYQQRPGQSPVLVIYQDNQRSSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSM--SVVFGGGTRLTVL. 105
14 -70.400sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  64  2YELTQPPSVSVSPGQTARITCSANALPNQYAYWYQQKPGRAPVMVIYKDTQRPSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNS--ASIFGGGTKLTVLG 107
15 -70.300sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  51  3.VLTQPPSASGTPGGRVTISCSGSSGSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSLDGYVFGTGTKVTVL. 111
16 -70.100sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  56  3.VLTQPPSVSGTPGQRVTISCSGGSTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRLSAVVFGGGTQLTVL. 111
17 -69.000sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  55  3.ALTQPASVSGSLGQSITISCTGTSGGYNYVSWFQQHPGTAPKLIISEVRNRPSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYTSS-NSVVFGGGTKLTVLG 111
18 -69.000sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  53  3.ALTQPPSASGSLGQSVTISCTGTSGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGS-DNFVFGTGTKVTVLG 111
19 -68.900sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  56  3.ALTQPRSVSGSPGQSVTISCTGTSGAYNSVSWYQQHPGKAPKLMIFDVTKRPSGVPDRLSGSKSGDTASLTISGLRADDEADYYCCSYAGR-YSVIFGGGTKLTVLG 111
20 -68.800sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  53  3.ALTQPPRVSGSPGQSVTISCTGSYTGYNHVSWYQQDPGKVPKLMIYDVDKRPSGVPDRFSGSKSANTASLTISGLQANNEADYYCSSYGGT-YSLIFGGGTKLTVLG 111
21 -68.500sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  49  3.ALTQPRSLSGSPGQAVTISCTGLPDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGN-YIFVFGQGTDLTVLG 111
22 -68.200sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  57  3.ALTQPRSVSGSPGQSVTISCAGTSGGNHFVSWYQQHPGKAPKLIIYGVNKRPSGVPYRFSGSKSGNTASLTISGLQAEDEAHYYCCSYAGR-FTWVFGGGTNLTVLG 111
23 -68.200sp|P01708|LV205_HUMAN Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  54  3.ALTQPRSVSGSPGHSVTISCIGTSGDYKYVSWYQQHPGKAPKLIIYEVSSRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYIGS---YVFGTGTKVIVLG 109
24 -68.200sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  56  3.VLTQPPSLSAAPGQRVSISCSGSSSGKNYVDWYQQLPGTAPKLLIFNNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNR--RSVFGGGTNVTVVG 109
25 -67.100sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  57  3.ALTQPPSASGSPGQSVTISCTGTSGDNKYVSWYQQHPGRAPKLVIFEVSQRPSGVPDRFSGSKSDNTASLTVSGLRAEDEADYYCSSYVDN-NNFVFGGGTKLTVL. 110
26 -67.000sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  50  3.ALTQPASVSASPGQSITISCTGTTGSYSYVSWYQQYPGKAPKVLIFDVNSRPSGVSHRFSGSKSGNTASLTISGLQAEDEAHYFCSSYRTS-GTIIFGGGTYVTVL. 110
27 -66.600sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  52  3.ALTQPASVSGSPGQSITISCTGTTGSYNFVSWYQQNPGKAPKLMIYEGNKRPSGVSNRFSGSKSGKTASLTISGLQVEDEADYYCCSYAGN-STRVFGGGTRVTVLS 111
28 -66.500sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  54  3.ALTQPRSVSGSPGQSLTISCSGAPDGCESVSWYQQHPGKAPKLIIYGFSNRPSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADS--SVIFGAGTKLTVL. 109
29 -66.400sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  38  4.MTQSPSTLSASVGDRVTITCRASQSINTWLAWYQQKPGKAPKLLMYKASSLESGVPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSD--SKMFGQGTKVEVKG 108
30 -66.300sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  38  4.MTQSPSSLSASVGDRVIITCRASQSSVDYLNWYQQKPGKAPKLLIFDTSNLQSGVPSRFSGGRSGTDFTLTISSLQPDDFATYYCQQSYTN-PEVTFGGGTTVDIK. 108
31 -66.100sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  56  3.VLTQPPSASGTPGQRVTISCFGSSSGRYYVYWYQQLPGTTPKLLIYKDNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDS--LWVFGGGTTLTVL. 108
32 -66.100sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  38  4.MTQSPSSLSASVGDRVTITCQASQDIRKHLNWYDQKPGKAPRLLIYGASTLETGVPSRFSGSGSGTDFTLTISTLQPEDIGNYYCQQYDNV--PITFGQGTRVENKG 108
33 -66.000sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  40  4.MTXSPSSLSASVGXRVTITCRASXTISSYLXWYXXKPGKAPXLLIYAASXLHSGVPSRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSS--PTTFGXGTRLXIK. 107
34 -65.900sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  37  4.MTQSPSTLSASVGDRVAITCRASQNISSWLAWYQQKPGKAPKVLIYKSSSLESGVPSRFSGSGSGTDFTLTISSLXPXXFATYYCQQYNTF---FTFGPGTKVDIK. 106
35 -65.800sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  40  4.MTQSPATLSVSPGERATLSCRASQSVSNNLAWYQQKPGQPPRLLIYGASTRATGIPARFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNWP-PWTFGQGTRVEIK. 108
36 -65.700sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  39  4.MTQSPSSLSASVGDRVTITCRAGHNITNFLSWYQQKPGKAPTLLIYAVSNLQVGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNF--SFTFGGGTKVDNK. 107
37 -65.600sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  37  4.MTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQKPGKAPKLLIYAASSLQSGVTSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYST--LITFGQGTRLEIK. 107
38 -65.500sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  37  4.MTQSPSSLSASVGDRVTITCRASQGIRNDLTWYQQKPGTAPKRLIYGATSLQSGVPSRFSGSGSGTEFTLTINSLQPEDFATYYCLQYSSF--PWTFGQGTKVEVK. 107
39 -65.400sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  35  4.LTQSPSSLSASVGDRVTITCRASQSVYNYVAWFQQKPGKAPKSLIYDASTLQSGVPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSY--PYTFGQGTKVQIK. 107
40 -65.400sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  37  4.MTQSPSPLSASVGDSVTITCQASQDIRNSLIWYQQKPGKAPKFLIYDAENLEIGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNL--PYTFGQGTKLEIK. 107
41 -65.300sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  37  4.MTQSPSSLSASVGDRVTITCQASQDISDYLNWYQQKPGKAPKLLIYDASNLESGVPSRFSGGGSGAHFTFTISSLQPEDIATYYCQQYDYL--PWTFGQGTKVEIK. 107
42 -65.300sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  38  4.MTQSPSSLSASVGDRVTITCRAGQSVNKYLNWYQQKPGKAPKVLIFAASSLKSGVPSRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTT--PYTFGPGTKVEMT. 107
43 -65.300sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  37  4.MTQSPSSLSASVGDRVTITCRASQSISSYLSWYQQKPGKAPQVLIYAASSLPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYIT--PTSFGQGTRVEIK. 107
44 -65.300sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  40  4.MTQSPSSLSASVGDRVTITCQASQDIIKYLNWYQQTPGKAPKLLIYEASNLQAGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSL--PYTFGQGTKLQIT. 107
45 -65.200sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  35  4.MTQSPSSLSASVGDRVTIICRASQGIRNDLTWYQQKPGKAPKELIYAASNLQSGVPSRFSGSGAGTEFTLTISSLQPEDFATYYCLQQNSY--PRSFGQGTKVEIK. 107
46 -65.200sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  41  4.MTQSPSSLSVSVGDRVTITCQASQNVNAYLNWYQQKPGLAPKLLIYGASTREAGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYNNW--PPTFGQGTKVEVK. 107
47 -65.200sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  35  4.MTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPKILIYDASNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTL--PRTFGQGTKLEIK. 107
48 -65.100sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  40  4.LTQSPGTLSLSPGESATLSCRASQSVSSNLAWYQQKRGQSPRLLIRDASSRANGIPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYSTS--PYTFGQGTKLEIK. 107
49 -65.100sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  35  4.MTQSPSTQPASVGDRVTITCRASQSINIWLAWYQQKPEKAPKLLIYKASTLETGVPSRFSGSGSGTEFTLTINSLQPDDFATYYCQQYSRY--PYTFGQGTKLDIK. 107
50 -65.000sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  39  4.MTQSPSSLSASVGDRVTITCQASQDISIFLNWYQQKPGKAPKLLIYDASKLEAGVPSRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNL--PLTFGGGTKVDFK. 107
51 -64.900sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  37  4.MTQSPSSVSASVGDRVTITCRASQDISHWLAWYQQKSGKAPKLLIYSASSLENGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQAHSV--PLTFGGGTTVDIK. 107
52 -64.900sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  39  4.MTQSPSTLSVSVGDRVTITCEASQTVLSYLNWYQQKPGKAPKLLIYAASSLETGVPSRFSGQGSGTXFTFTISSVXPXXFATYYCQXYLDL--PRTFGQGTKVDLK. 107
53 -64.700sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  38  4.MTQSPSSLSASVGDRVTITCRASQDITNYVNWFQQRPGQAPKVLIYGASILETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDTL--PLTFGGGTKVDIK. 107
54 -64.500sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  57  2FMLTQPHSVSESPGKTVIISCTRSDIAGYYVQWYQQRPGRAPTTVIFEDTQRPSGVPDRFSGSISSNSASLTISGLQTEDEADYYCQSYDRD--HWVFGGGTKLTVLG 111
55 -64.100sp|P06319|LV605_HUMAN(removed signalp:1-19) Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1  ali follow..  56  3.MLTQPHSVSESPGKTVTISCTGNSIASNYVQWYQQRRVSAPTIVIYEDNQRPLGVPDRFSGSISSNSASLTISGLKTEDEADYYCQSFDNTNQG-VFGGGTKLTVLG 112
56 -63.900sp|P01721|LV601_HUMAN Ig lambda chain V-VI region AR OS=Homo sapiens PE=1 SV=1  ali follow..  55  3.MLTQPHSVSESPGKTVTFSCTGSGIADSFVQWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSISANSASLTISGLKTEDEADYYCQSYNSNHHV-VFGGGTKVTVLG 112
57 -63.700sp|P06318|LV604_HUMAN Ig lambda chain V-VI region WLT OS=Homo sapiens PE=1 SV=1  ali follow..  53  3.MLTQPLSVSGSPEKTVTISCTGSSIGSNYVQWYQQRPGSAPTNVIYENNQRPSEVPDRFSGSISSNSASLTISGLKTEDEADYYCQSYDNNNH--VVFGGTRLTVLG 111
58 -63.300sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  40  4.LTQSPLSLPVTPGEPASISCRSSQSXGXYLDWYLXKPGXSPXLLIYLGSNRASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQT--PLTFGGGTNVEIK. 111
59 -63.200sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  40  4.MTQSPDSLAVSLGERATINCKSSQNSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYST--PYSFGQGTKLEIK. 113
60 -63.100sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  41  4.LTQSPGTLSLSPGERATLSCRASQSSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTS--PRTFGQGTKVEIK. 108
61 -63.000sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  38  4.MTQSPVTLSVSPGERATLSCRASSISNSYLAWYQQKPSGSPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWP--PTFGQGTRVEIK. 108
62 -63.000sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  43  4.LTXSPGTLSLSPGXRAALSCRASQSSGNYLAWYQQKPGQAPRLLMYGVSSRATGIPDRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSS--PFTFGQGSKLEIK. 108
63 -62.900sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  41  4.MTQSPDSLAVSLGERATINCKSSQSNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP---TFGGGTKVEIK. 112
64 -62.900sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  41  4.LTQSPGTLSLSPGERATLSCRASQSSNSFLAWYQQKPGQAPRLLIYVASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSS--PSTFGQGTKVELK. 108
65 -62.700sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  41  4.MTQSPLSLPVTPGEPASISCRSSQSGFDYLNWYLQKPGQSPXLLIYALSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQA--PITFGQGTRLEIK. 112
66 -62.600sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  42  4.LTQSPGTLSLSPGERATLSCRASQSSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSS--PWTFGQGTKVEIK. 108
67 -62.500sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  40  4.LTQSPGTLSLSPGERATLSCRASQSSNSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSS--PQTFGQGSKVEIK. 108
68 -62.400sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  32  4.MTQSPSSLSATVGDRVTLLCEASQSGNTFLAWYQQKPKKAPKLLIYDASNLETGVPSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLPS--TFGVASKVESK. 111
69 -62.400sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  39  4.MTQSPDSLAVSLGERATINCKSSQSNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNL--PWTFGQGTKVEIK. 113
70 -62.300sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  40  5.MTQTPLSLPVTPGEPASISCRSSQSGNTYLNWYLQKAGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEI--PYTFGQGTKLEIR. 114
71 -62.300sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  41  4.LTQSPGTLSLSPGERATLSCRAALSSRGYLAWYQQKPGQAPRLLMYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSS--PRSFGQGTKVEIK. 108
72 -62.200sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  40  8.MTQSPLSLPVTPGEPASISCRSSQSGYNYLDWYLQKPQQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQT--PQTFGQGTKVEIK. 116
73 -62.200sp|P01722|LV602_HUMAN Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1  ali follow..  49  3.MLIQPPSVSESPGKTVTMSCTRTSIASNYVQWYRQRPGGAPTTLIYDTNQRPYGVPNRFSGSSSSNSASLTISGLTNDDTAMYFCQSYDSS-NLWVFGGGTKLTVLS 112
74 -62.000sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  39  4.MTQSPLSLPVTLGQPASISCRSSQDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHW--SWTFGQGTKVEIK. 112
75 -61.900sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  41  4.LTQSPGTLSLSPGERATLSCRASQSSSGYLGWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSL--GRTFGQGTKVEIK. 108

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.