current user: public

If you have questions about the server, please let us know.

Query: sp|P01733|TVB1_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region YT35 OS=Homo sapiens GN=TRBV12-3 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst GVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSFSTCSANYGYTFGSGTRLTVVLast
1 -77.900sp|P01733|TVB1_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region YT35 OS=Homo sapiens GN=TRBV12-3 PE=1 SV=1  ali  100  1GVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSFSTCSANYGYTFGSGTRLTVV 114
2 -72.700sp|P04435|TVB2_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region CTL-L17 OS=Homo sapiens GN=TCRB PE=2 SV=1  ali follow..  53  1GVSQNPRHNITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLAG--LNQPQHFGDGTRLSIL 112
3 -60.600sp|P80421|HV108_HUMAN Ig heavy chain V-I region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  23  3.QLVQSGVERKVPGASVRISCKASGENYYIHWVRQAPGLGLEWMGIFNPVAGAVSSEKFRDRLVMSSDSANTVSMQLRNLRSDDTGRYFCARVSYDFSQYGMDVWGQGTTVIVS 119
4 -59.700sp|P03979|TVC_HUMAN(removed signalp:1-17) T-cell receptor gamma chain V region PT-gamma-1/2 OS=Homo sapiens GN=TRGV3 PE=2 SV=1  ali follow..  22  5.LEGRTKSVTRQTGSSAEITCDLTVNTFYIHWYLHQEGKAPQRLLYYDVSTARLESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRXK-NYYKKLFGSGTTLVVT 119
5 -59.200sp|P01737|TVA3_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region PY14 OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.VTQLGSHVSVSEGALVLLRCNYSSSPPYLFWYVQYPNQGLQLLLKYTSAA---TLVKGINGFEAEFKSETSFHLTKPSAHMSDAAEYFCAVSDLEPNSSSKIIFGSGTRLSI. 114
6 -58.600sp|P01824|HV206_HUMAN Ig heavy chain V-II region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  18  3.QLQESGPGLVKPSETLSLTCIVSGTGYYWGWIRQPPGKGLEWIGGVYYTGSIYYNPSLRGRVTISVDSRNQFSLNLRSMSAADTAMYYCARGNPPPYYDGIDVWGQGTTVHVS 128
7 -58.600sp|P01817|HV204_HUMAN Ig heavy chain V-II region MCE OS=Homo sapiens PE=1 SV=1  ali follow..  23  3.TLKESGPTLVKPTETLTLTCTFSGSGVGVGWIRQRPGKALEWLAFINWDDDNRYSPSLRSRLTGTKDSRNQVVLTITNMDPVDSGTYFCAHRPPTGNLGGFDXWGQGTLVTVS 124
8 -58.400sp|P06331|HV209_HUMAN(removed signalp:1-20) Ig heavy chain V-II region ARH-77 OS=Homo sapiens PE=4 SV=1  ali follow..  22  3.QLQQWGAGLVKPSETLSLTCAVFGSGYYWSWIRQPPGRGLEWIGEINHSGSTNYKTSLKSRVTISLDSKNLFSLKLSSVTAADTAVYYCARGLLRGGYYGMDVWGQGTTVTVS 125
9 -58.400sp|P01814|HV201_HUMAN Ig heavy chain V-II region OU OS=Homo sapiens PE=1 SV=1  ali follow..  23  3.TLTESGPALVKPKQPLTLTCTFSGSRMRVSWIRRPPGKALEWLARIXXXDKFYWSTSLRTRLSISKNSKNQVVLIMINVNPVDTATYYCARVVNSVMAYYMDVWGKGTTVTVS 125
10 -58.000sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.MTQSPSSLSASVGDRVIITCRASQSVDYLNWYQQKPGKAPKLLIFDTSN----LQSGVPSRFSGGRSGTD-FTLTISSLQPDDFATYYCQQSYTN----PEVTFGGGTTVDI. 107
11 -57.800sp|P01771|HV310_HUMAN Ig heavy chain V-III region HIL OS=Homo sapiens PE=1 SV=1  ali follow..  21  3.KLVQAGGGVVQPGRSLRLSCIASGSNYGMHWVRQAPGKGLEWVAVIYNGSRTYYGDSVKGRFTISRDSKRTLYMXMNSLRTEDTAVYYCARDPDILTAFSFDYWGQGVLVTVS 120
12 -57.500sp|P01825|HV207_HUMAN Ig heavy chain V-II region NEWM OS=Homo sapiens PE=1 SV=1  ali follow..  22  3.QLEQSGPGLVRPSQTLSLTCTVSGSNDYYTWVRQPPGRGLEWIGYVFYHGTSDDTTPLRSRVTMLVDSKNQFSLRLSSVTAADTAVYYCARNLIA---GCIDVWGQGSLVTVS 116
13 -57.400sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  31  4.MTQSPATLSVSPGERATLSCRASQSSNNLAWYQQKPGQPPRLLIYGAST----RATGIPARFSGSGSGTE-FTLTISRLQSEDFAVYYCQQYNNWP----PWTFGQGTRVEI. 107
14 -57.400sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  30  4.MTQSPDSLAVSLGERATINCKSSQNKNYLAWYQQKPGQPPKLLIYWAST----RESGVPDRFSGSGSGTD-FTLTISSLQAEDVAVYYCQQYDTIP------TFGGGTKVEI. 111
15 -57.400sp|P04437|TVA2_HUMAN(removed signalp:1-21) T-cell receptor alpha chain V region CTL-L17 OS=Homo sapiens GN=TCRA PE=2 SV=1  ali follow..  31  9.VKQNSPSLSVQEGRISILNCDYTNSFDYFLWYKKYPAEGPTFLISISSIK----DKNEDGRFTVFLNSAKHLSLHIVPSQPGDSAVYFCAAKGAG--TASKLTFGTGTRLQVT 117
16 -57.300sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  31  4.MTQSPSSLSATVGDRVTLLCEASQGNTFLAWYQQKPKKAPKLLIYDASN----LETGVPSRFSESGSGTD-FTFTISGLXPXXFAVYYCQXYDTLPS-----TFGVASKVES. 110
17 -57.300sp|P01816|HV203_HUMAN Ig heavy chain V-II region DAW OS=Homo sapiens PE=1 SV=1  ali follow..  23  3.TLRESGPALVRPTQTLTLTCTFSGETMCVAWIRQPPGEALEWLAWDILNDDKYYGASLETRLAVSKDSKNQVVLSMNTVGPGDTATYYCARSCGS---QYFDYWGQGILVTVS 118
18 -57.300sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  28  4.MTQSPSTLSASVGDRVAITCRASQNSSWLAWYQQKPGKAPKVLIYKSSS----LESGVPSRFSGSGSGTD-FTLTISSLXPXXFATYYCQQYNTF------FTFGPGTKVDI. 105
19 -57.200sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  33  4.MTQSPDSLAVSLGERATINCKSSQSKNYLAWYQQKPGQPPKLLIYWAST----RESGVPDRFSGSGSGTD-FTLTISSLQAEDVAVYYCQQYYST-----PYSFGQGTKLEI. 112
20 -57.000sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  32  4.LTXSPGTLSLSPGXRAALSCRASQSGNYLAWYQQKPGQAPRLLMYGVSS----RATGIPDRFSGSGSGAD-FTLTISRLXPEDFAVYYCQQYGSS-----PFTFGQGSKLEI. 107
21 -57.000sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  32  4.LTQSPGTLSLSPGERATLSCRASQSSSYLAWYQQKPGQAPRLLIYGASS----RATGIPDRFSGSGSGTD-FTLTISRLEPEDFAVYYCQQYGTS-----PRTFGQGTKVEI. 107
22 -57.000sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  30  4.MTQSPDSLAVSLGERATINCKSSQNKNYLAWYQQKPGQPPKLLIYWAST----RESGVPDRFSGSGSGTD-FTLTISSLQAEDVAVYYCQQYYNL-----PWTFGQGTKVEI. 112
23 -56.900sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  33  4.LTQSPGTLSLSPGERATLSCRASQSNSFLAWYQQKPGQAPRLLIYVASS----RATGIPDRFSGSGSGTD-FTLTISRLEPEDFAVYYCQQYGSS-----PSTFGQGTKVEL. 107
24 -56.900sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  30  4.MTQSPVTLSVSPGERATLSCRASQSNSYLAWYQQKPSGSPRLLIYGAST----RATGIPARFSGSGSGTE-FTLTISSLQSEDFAVYYCQQYNNWP-----PTFGQGTRVEI. 107
25 -56.900sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  36  4.MTQSPSSLSASVGDRVTITCRASQSSNYLNWYQQKPGKAPKLLIYAASS----LQSGVTSRFSGSGSGTD-FTLTISSLQPEDSATYYCQQSYST-----LITFGQGTRLEI. 106
26 -56.900sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.MTQSPSSLSASVGDRVTITCQASQDSIFLNWYQQKPGKAPKLLIYDASKL----EAGVPSRFSGTGSGTD-FTFTISSLQPEDIATYYCQQFDNL-----PLTFGGGTKVDF. 106
27 -56.800sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  33  3.VLTQPPSVSGTPGQRVTISCSGGSSNNYVYWYQQLPGTAPKLLIYRDDK----RPSGVPDRFSGSKSGTS-ASLAISGLRSEDEAHYHCAAWDYRLSA---VVFGGGTQLTVL 111
28 -56.800sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.MTQSPSTLSVSVGDRVTITCEASQTLSYLNWYQQKPGKAPKLLIYAASS----LETGVPSRFSGQGSGTX-FTFTISSVXPXXFATYYCQXYLDLP-----RTFGQGTKVDL. 106
29 -56.700sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  33  4.MTQSPSSLSASVGDRVTITCRAGHNTNFLSWYQQKPGKAPTLLIYAVSN----LQVGVPSRFSGSGSGAE-FTLTISSLQPEDFATYYCQQNYNF-----SFTFGGGTKVDN. 106
30 -56.700sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  30  4.MTQSPSSLSASVGDRVTITCRAGQSNKYLNWYQQKPGKAPKVLIFAASS----LKSGVPSRFSGSGSGTD-FTLTISGLLPEDFATYYCQQSYTTP-----YTFGPGTKVEMT 107
31 -56.500sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  32  4.MTQSPSSLSASVGDRVTIICRASQGRNDLTWYQQKPGKAPKELIYAASNL----QSGVPSRFSGSGAGTE-FTLTISSLQPEDFATYYCLQQNSY-----PRSFGQGTKVEI. 106
32 -56.500sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  32  4.LTQSPGTLSLSPGERATLSCRASQSNSYLAWYQQKPGQAPRLLIYGASS----RATGIPDRFSGSGSGTD-FTLTISRLEPDDFAVYYCQQYGSS-----PQTFGQGSKVEI. 107
33 -56.500sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.VLTQPPSASGTPGGRVTISCSGSSSNXPAYWYQQLPGTAPKLLIYNYNQ----RPSGVPDRFSASR-SGTSASLAISGLQSEDEADYYCAAWDDSLDG---YVFGTGTKVTVL 111
34 -56.500sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  33  4.LTQSPGTLSLSPGESATLSCRASQSSSNLAWYQQKRGQSPRLLIRDASS----RANGIPDRFSGSGSGTD-FTLIISRLEPEDFAVYYCQQYSTSP-----YTFGQGTKLEI. 106
35 -56.500sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  33  4.MTQSPSSLSASVGDRVTITCRASQGRNDLTWYQQKPGTAPKRLIYGATS----LQSGVPSRFSGSG-SGTEFTLTINSLQPEDFATYYCLQYSSF-----PWTFGQGTKVEV. 106
36 -56.500sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  31  4.MTQSPSSLSASVGDRVTITCQASQDSDYLNWYQQKPGKAPKLLIYDASN----LESGVPSRFSGGGSGAH-FTFTISSLQPEDIATYYCQQYDYLP-----WTFGQGTKVEI. 106
37 -56.400sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  30  4.MTQSPSSLSVSVGDRVTITCQASQNNAYLNWYQQKPGLAPKLLIYGASTR----EAGVPSRFSGSGSGTD-FTFTISSLQPEDIATYYCQQYNNWP-----PTFGQGTKVEV. 106
38 -56.400sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  33  4.LTQSPGTLSLSPGERATLSCRASQSSSYLAWYQQKPGQAPRLLIYGASS----RATGIPDRFSGSGSGTD-FTLTISRLEPXDFAVYYCQQYGSS-----PWTFGQGTKVEI. 107
39 -56.400sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  30  4.MTQSPSSLSASVGDRVTITCRASQSSSYLSWYQQKPGKAPQVLIYAASS----LPSGVPSRFSGSGSGTD-FTLTISSLQPEDFATYYCQQNYITP-----TSFGQGTRVEI. 106
40 -56.400sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  27  4.MTQSPSSLSASVGDRVTITCRASQDTNYVNWFQQRPGQAPKVLIYGASIL----ETGVPSRFSGSGSGTD-FTFTISSLQPEDIATYYCQQYDTL-----PLTFGGGTKVDI. 106
41 -56.300sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  33  4.MTQSPSSLSASVGDRVTITCQASQDIKYLNWYQQTPGKAPKLLIYEASN----LQAGVPSRFSGSGSGTD-YTFTISSLQPEDIATYYCQQYQSLP-----YTFGQGTKLQIT 107
42 -56.300sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  32  8.MTQSPLSLPVTPGEPASISCRSSQGYNYLDWYLQKPQQSPQLLIYLGSN----RASGVPDRFSGSGSGTD-FTLKISRVEAEDVGVYYCMQGLQT-----PQTFGQGTKVEI. 115
43 -56.300sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  27  4.LTQSPSSLSASVGDRVTITCRASQSYNYVAWFQQKPGKAPKSLIYDAST----LQSGVPSNFTGSGSGTD-FILTISSLQPEDFATYYCQQYNSY-----PYTFGQGTKVQI. 106
44 -56.300sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  30  4.MTQSPSSLSASVGDRVTITCQASQDNHYLNWYQQGPKKAPKILIYDASN----LETGVPSRFSGSGFGTD-FTFTISGLQPEDIATYYCQQYDTL-----PRTFGQGTKLEI. 106
45 -56.200sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  35  4.MTXSPSSLSASVGXRVTITCRASXTSSYLXWYXXKPGKAPXLLIYAASX----LHSGVPSRFSGSGSGTX-FTFTISSLXPXXFATYYCXXSYSS-----PTTFGXGTRLXI. 106
46 -56.200sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  32  4.MTQSPSPLSASVGDSVTITCQASQDRNSLIWYQQKPGKAPKFLIYDAEN----LEIGVPSRFRGSGSGTD-FALSISSLQPEDFATYYCQQYYNLP-----YTFGQGTKLEI. 106
47 -56.200sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  31  4.LTQSPGTLSLSPGERATLSCRAALSRGYLAWYQQKPGQAPRLLMYGASS----RATGIPDRFSGSGSGTD-FTLTISRLEPEDFAVYYCQQYGSS-----PRSFGQGTKVEI. 107
48 -56.200sp|P01767|HV306_HUMAN Ig heavy chain V-III region BUT OS=Homo sapiens PE=1 SV=1  ali follow..  21  3.QLVETGGGLIQPGGSLRLSCAASGSXHSMSWVRQAPGKALXWVSAIYRGGTTYYADSVKGRFTISRDSRXTVYLQMXSLRAEDTAVYYCARDLAA-----ARLFGKGTTVTVS 114
49 -56.200sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  37  3.VLTQPPSVSAAPGQEVTISCSGSSGDNFVSWYQQLPGTAPKLLIYDNNK----RPSGIPDRFSGSKSGTS-ATLGITGLQTGDEADYYCGTWDSS---LSVGMFGGGTRVTVL 110
50 -56.200sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  29  1SELTQDPAVSVALGQTVRITCQGDSRGYDAAWYQQKPGQAPLLVIYGRNN----RPSGIPDRFSGSS-SGHTASLTITGAQAEDEADYYCNSRDSS---GKHVLFGGGTKLTVL 107
51 -56.100sp|P01772|HV311_HUMAN Ig heavy chain V-III region KOL OS=Homo sapiens PE=1 SV=1  ali follow..  23  3.QLVESGGGVVQPGRSLRLSCSSSGSSYAMYWVRQAPGKGLEWVAIIWDDSDQHYADSVKGRFTISRDSKNTLFLQMDSLRPEDTGVYFCARDGGSASCFGPDYWGQGTPVTVS 125
52 -56.100sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  32  4.MTQSPSTQPASVGDRVTITCRASQSNIWLAWYQQKPEKAPKLLIYKAST----LETGVPSRFSGSGSGTE-FTLTINSLQPDDFATYYCQQYSRY-----PYTFGQGTKLDI. 106
53 -56.100sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.LTQSPLSLPVTPGEPASISCRSSQNGXYLDWYLXKPGXSPXLLIYLGSN----RASGVPNRFSGSGSGTX-FTLKISRVXAXXVGVYYCMQALQTP-----LTFGGGTNVEI. 110
54 -56.000sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  35  3.VLTQPPSVSAAPGQKVTISCSGSSGNDYVSWYQQVPGTAPKLLIYDNNK----RPSGIPDRFSGSKSGTS-ATLGITGLQTGDEADYYCGTWNNS---LSGWVFGGGTKLTVL 110
55 -55.900sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  33  3.VLTQPPSVSAAPGQKVTISCSGGSGNNYVSWHQHLPGTAPKLLIYEDNK----RPSGIPDRISASKSGTS-ATLGITGLRTGDEADYYCATWDSS---LNAVVFGGGTKVTVL 110
56 -55.900sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  31  2.VLTQPPSVSVAPGETARLTCGGNDGSESVHWYQQKPGQAPVLVIYFDRDR----PSGIPERFSGS-NSGNTATLTISRVEAGDEADYYCQLWDSS---SEHVVFGGGTKLTVL 107
57 -55.900sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  25  3.ALTQPASVSASPGQSITISCTGTTSYSYVSWYQQYPGKAPKVLIFDVNS----RPSGVSHRFSGSK-SGNTASLTISGLQAEDEAHYFCSSYRTS----GTIIFGGGTYVTVL 110
58 -55.900sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  27  2.VLSQPPSVSVAPGQTARITCGGDGGGKSVHWYQQKPGQAPVLVVHEDND----RPAGIPERFSGSN-SGNTAALTISRVEAGDEADYYCEVWDDR---TAHVVFGGGTKLTVL 107
59 -55.900sp|P04436|TVA1_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region HPB-MLT (Fragment) OS=Homo sapiens PE=2 SV=1  ali follow..  33  3.VTQAQTEISVVEKEDVTLDCVYETTTYYLFWYKQPPSGELVFLIRRNSFD---EQNEISGRYSWNFQSTSSFNFTITASQVVDSAVYFCALDSSASKI----IFGSGTRLSI. 110
60 -55.900sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  29  3.ALTQPASVSGSPGQSITISCTGTTGYDFVSWYQQHPGKAPKLLIYDVNS----RPSGISNRFSGSK-SGNTASLTISGLQAEDEADYYCSSFTTT---NSRAVFGGGTKLSVL 111
61 -55.800sp|P06326|HV107_HUMAN Ig heavy chain V-I region Mot OS=Homo sapiens PE=1 SV=1  ali follow..  22  3.QLVQSGAEVKKPGSSARLSCKVSGNTYDIHWVRQAPGRGLEWMAVVPSDDRTTYGPRSQARFTVTRDSTTTVYMELTALISADTAIYYCARGAHYSDTTSLGPWGQGTLLIVS 124
62 -55.800sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  32  4.MTQSPSSVSASVGDRVTITCRASQDSHWLAWYQQKSGKAPKLLIYSASS----LENGVPSRFSGSGSGTE-FTLTISSLQPEDFATYFCQQAHSVP-----LTFGGGTTVDI. 106
63 -55.800sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  27  3.ALTQPASVSGSPGQSITISCTGTTSYNFVSWYQQNPGKAPKLMIYEGNK----RPSGVSNRFSGSK-SGKTASLTISGLQVEDEADYYCCSYAGN----STRVFGGGTRVTVL 110
64 -55.700sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  28  4.MTQSPSTLSASVGDRVTITCRASQSNTWLAWYQQKPGKAPKLLMYKASSL----ESGVPSRFIGSGSGTE-FTLTISSLQPDDFATYYCQQYNSD-----SKMFGQGTKVEVK 107
65 -55.700sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  27  3.ALTQPPSASGSPGQSVTISCTGTSDNKYVSWYQQHPGRAPKLVIFEVSQ----RPSGVPDRFSGSK-SDNTASLTVSGLRAEDEADYYCSSYVDN----NNFVFGGGTKLTVL 110
66 -55.700sp|P01744|HV104_HUMAN(removed signalp:1-19) Ig heavy chain V-I region ND (Fragments) OS=Homo sapiens PE=1 SV=2  ali follow..  24  3.QLVQSGAEVRKPGASVRVSCKASGIDSYIHWIRQAPGHGLEWVGWINPSGGTNYAPRFQGRVTMTRDSFSTAYMDLRSLRSDDSAVFYCAKSDPFWSDYTLDVWGQGTTVTVS 127
67 -55.700sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  29  5.ELTQPPSVSLAAGQTAMITCEGNDGERSVHWYQQKPGQAPVPVIYDDAD----RPSGVPARFSGYNSGNS-AILTINRVEAGDEADYFCQSWDNG---SYEVVFGTGTMVTVL 110
68 -55.700sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  33  2SALTQPRSLSGSPGQAVTISCTGLPSDNFVSWYQQTPGRAPRLLIYDDSL----RPSGVPNRFSGSKSDTK-AALTISGLQPDDEATYFCCSYVGN----YIFVFGQGTDLTVL 110
69 -55.700sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  34  4.LTQSPGTLSLSPGERATLSCRASQSSGYLGWYQQKPGQAPRLLIYGASS----RATGIPDRFSGSGSGTD-FTLTISRLEPEDFAVYYCQQYGSL-----GRTFGQGTKVEI. 107
70 -55.600sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  33  4.MTQSPLSLPVTPGEPASISCRSSQGFDYLNWYLQKPGQSPXLLIYALSN----RASGVPDRFSGSG-SGTDFTLKISRVEAEDVGVYYCMXALQA-----PITFGQGTRLEI. 111
71 -55.500sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  32  3.VLTQPPSASGTPGQRVTISCSGGNGRNSVNWYQVHPGTAPRLLIYSSDQ----RSSGVPDRFSGSKSG-TSASLAISGLQSENEADYFCATWDDS---LDGPVFGGGTKVTVL 110
72 -55.500sp|P83593|KV405_HUMAN Ig kappa chain V-IV region STH (Fragment) OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.MTQSPDSLVVSLGERATINCRSSQNKNYLAWYQQKPGQAPKLLFSWAST----RESGVPDRFSGSGSGTD-FTLTIPGLQAEDVAVYYCQQYYRIP-----YTFGQGAK.... 109
73 -55.400sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  30  3.ALTQPRSVSGSPGQSVTISCTGTSAYNSVSWYQQHPGKAPKLMIFDVTK----RPSGVPDRLSGSKSGDT-ASLTISGLRADDEADYYCCSYAGR----YSVIFGGGTKLTVL 110
74 -55.400sp|P01782|HV321_HUMAN Ig heavy chain V-III region DOB OS=Homo sapiens PE=1 SV=1  ali follow..  21  3.QLVESGGDLVQPGRSLRLSCAASGHEYNMHWLRQGPGKGPEWVSTITWNGSVLYADSVKGRFAISRDAQKTLYLQLNILRPEDTAFYYCAKGYIW-NGNWFDSWGQGTLVTVS 119
75 -55.400sp|P01768|HV307_HUMAN Ig heavy chain V-III region CAM OS=Homo sapiens PE=1 SV=1  ali follow..  20  3.ELVESGGGVVXPGRSLRLSCAASGSNYAMHWVRQPPGKGLEWVAVISYXGXKYYAXSVKGRFTISRDSKXTLYLQMNSLRAEXTAVYYCARDRPLYGXRAFNYWGQGTLVTVS 121

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.