current user: public

If you have questions about the server, please let us know.

Query: sp|P01737|TVA3_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region PY14 OS=Homo sapiens PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst QSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSDLEPNSSASKIIFGSGTRLSIRLast
1 -76.500sp|P01737|TVA3_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region PY14 OS=Homo sapiens PE=1 SV=1  ali  100  1QSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSDLEPNSSASKIIFGSGTRLSIR 115
2 -67.300sp|P04436|TVA1_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region HPB-MLT (Fragment) OS=Homo sapiens PE=2 SV=1  ali follow..  39  1QKVTQAQTEISVVEKEDVTLDCVYETRTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALDSSASKI-----IFGSGTRLSIR 111
3 -66.300sp|P04437|TVA2_HUMAN(removed signalp:1-21) T-cell receptor alpha chain V region CTL-L17 OS=Homo sapiens GN=TCRA PE=2 SV=1  ali follow..  32  7QQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISISSIKDK-NEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAAKGAGTASK---LTFGTGTRLQVT 117
4 -62.800sp|P03979|TVC_HUMAN(removed signalp:1-17) T-cell receptor gamma chain V region PT-gamma-1/2 OS=Homo sapiens GN=TRGV3 PE=2 SV=1  ali follow..  22  3SNLEGRTKSVTRQTGSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDVSTARSGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRXKNY--YKKLFGSGTTLVV. 118
5 -62.000sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  34  3.QMTQSPSSLSASVGDRVIITCRASQSSVDYLNWYQQKPGKAPKLLIFDTS-NLQSGVPSRFSGG--RSGTDFTLTISSLQPDDFATYYCQQSYT-----NPEVTFGGGTTVDIK 108
6 -61.600sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  33  3.VMTQSPATLSVSPGERATLSCRASQSVSNNLAWYQQKPGQPPRLLIYGAS-TRATGIPARFSGS--GSGTEFTLTISRLQSEDFAVYYCQQYNN-----WPPWTFGQGTRVEIK 108
7 -61.500sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  37  3.QMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQKPGKAPKLLIYAAS-SLQSGVTSRFSGS--GSGTDFTLTISSLQPEDSATYYCQQSYS------TLITFGQGTRLEIK 107
8 -61.400sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  29  3.QMTQSPSSLSASVGDRVTITCRAGHNITNFLSWYQQKPGKAPTLLIYAVS-NLQVGVPSRFSGS--GSGAEFTLTISSLQPEDFATYYCQQNYN------FSFTFGGGTKVDNK 107
9 -61.200sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  30  3.QMTQSPSSLSASVGDRVTITCQASQDISIFLNWYQQKPGKAPKLLIYDASKLEA-GVPSRFSGT--GSGTDFTFTISSLQPEDIATYYCQQFDN------LPLTFGGGTKVDFK 107
10 -61.100sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  32  3.VLTQSPGTLSLSPGESATLSCRASQSVSSNLAWYQQKRGQSPRLLIRDAS-SRANGIPDRFSGS--GSGTDFTLIISRLEPEDFAVYYCQQYST------SPYTFGQGTKLEIK 107
11 -61.100sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  30  3.QMTQSPSTLSASVGDRVAITCRASQNISSWLAWYQQKPGKAPKVLIYKSSSLES-GVPSRFSGS--GSGTDFTLTISSLXPXXFATYYCQQYNTF-------FTFGPGTKVDIK 106
12 -61.100sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  33  3.QMTQSPSTLSVSVGDRVTITCEASQTVLSYLNWYQQKPGKAPKLLIYAAS-SLETGVPSRFSGQ--GSGTXFTFTISSVXPXXFATYYCQXYLD------LPRTFGQGTKVDLK 107
13 -61.000sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.QMTQSPSSLSASVGDRVTITCQASQDISDYLNWYQQKPGKAPKLLIYDAS-NLESGVPSRFSGG--GSGAHFTFTISSLQPEDIATYYCQQYDY------LPWTFGQGTKVEIK 107
14 -60.900sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  34  3.QMTQSPSSLSASVGDRVTITCRASQSISSYLSWYQQKPGKAPQVLIYAAS-SLPSGVPSRFSGS--GSGTDFTLTISSLQPEDFATYYCQQNYI------TPTSFGQGTRVEIK 107
15 -60.900sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  29  3.QMTQSPSSLSASVGDRVTIICRASQGIRNDLTWYQQKPGKAPKELIYAASNLQS-GVPSRFSGS--GAGTEFTLTISSLQPEDFATYYCLQQNS------YPRSFGQGTKVEIK 107
16 -60.900sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  32  3.QMTQSPSSLSVSVGDRVTITCQASQNVNAYLNWYQQKPGLAPKLLIYGAS-TREAGVPSRFSGS--GSGTDFTFTISSLQPEDIATYYCQQYNN------WPPTFGQGTKVEVK 107
17 -60.800sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  28  3.QMTQSPSSLSASVGDRVTITCRASQGIRNDLTWYQQKPGTAPKRLIYGATSLQS-GVPSRFSGS--GSGTEFTLTINSLQPEDFATYYCLQYSS------FPWTFGQGTKVEVK 107
18 -60.800sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  30  3.QMTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPKILIYDASNLET-GVPSRFSGS--GFGTDFTFTISGLQPEDIATYYCQQYDT------LPRTFGQGTKLEIK 107
19 -60.800sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  30  3.QMTQSPSSLSASVGDRVTITCRASQDITNYVNWFQQRPGQAPKVLIYGASILET-GVPSRFSGS--GSGTDFTFTISSLQPEDIATYYCQQYDT------LPLTFGGGTKVDIK 107
20 -60.700sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  29  3.QMTQSPSPLSASVGDSVTITCQASQDIRNSLIWYQQKPGKAPKFLIYDAE-NLEIGVPSRFRGS--GSGTDFALSISSLQPEDFATYYCQQYYN------LPYTFGQGTKLEIK 107
21 -60.600sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.QLTQSPSSLSASVGDRVTITCRASQSVYNYVAWFQQKPGKAPKSLIYDAS-TLQSGVPSNFTGS--GSGTDFILTISSLQPEDFATYYCQQYNS------YPYTFGQGTKVQIK 107
22 -60.500sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.XMTQSPSSLSASVGDRVTITCRAGQSVNKYLNWYQQKPGKAPKVLIFAAS-SLKSGVPSRFSGS--GSGTDFTLTISGLLPEDFATYYCQQSYT------TPYTFGPGTKVEMT 107
23 -60.300sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  38  3.QMTXSPSSLSASVGXRVTITCRASXTISSYLXWYXXKPGKAPXLLIYAAS-XLHSGVPSRFSGS--GSGTXFTFTISSLXPXXFATYYCXXSYS------SPTTFGXGTRLXIK 107
24 -60.300sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  32  3.QMTQSPSSVSASVGDRVTITCRASQDISHWLAWYQQKSGKAPKLLIYSAS-SLENGVPSRFSGS--GSGTEFTLTISSLQPEDFATYFCQQAHS------VPLTFGGGTTVDIK 107
25 -60.300sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  32  3.QMTQSPSTQPASVGDRVTITCRASQSINIWLAWYQQKPEKAPKLLIYKASTLET-GVPSRFSGS--GSGTEFTLTINSLQPDDFATYYCQQYSR------YPYTFGQGTKLDIK 107
26 -59.900sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.QMTQSPSSLSASVGDRVTITCQASQDIIKYLNWYQQTPGKAPKLLIYEAS-NLQAGVPSRFSGS--GSGTDYTFTISSLQPEDIATYYCQQYQS------LPYTFGQGTKLQIT 107
27 -59.900sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.QMTQSPSTLSASVGDRVTITCRASQSINTWLAWYQQKPGKAPKLLMYKASSLES-GVPSRFIGS--GSGTEFTLTISSLQPDDFATYYCQQYNS------DSKMFGQGTKVEVK 107
28 -59.600sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.QMTQSPSSLSASVGDRVTITCQASQDIRKHLNWYDQKPGKAPRLLIYGASTLET-GVPSRFSGS--GSGTDFTLTISTLQPEDIGNYYCQQYDN------VPITFGQGTRVENK 107
29 -59.200sp|P01733|TVB1_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region YT35 OS=Homo sapiens GN=TRBV12-3 PE=1 SV=1  ali follow..  31  2..VIQSPRHEVTEMGQEVTLRCKPISG-HNSLFWYRQTMMRGLELLIYFNNNVDSGMPEDRFSAKMP-NASFSTLKIQPSEPRDSAVYFCASSFSTCSAN-YGYTFGSGTRLTV. 113
30 -59.000sp|P04435|TVB2_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region CTL-L17 OS=Homo sapiens GN=TCRB PE=2 SV=1  ali follow..  30  2..VSQNPRHNITKRGQNVTFRCDPISE-HNRLYWYRQTLGQGPEFLTYFQNEAQSRLLSDRFSAERP-KGSFSTLEIQRTEQGDSAMYLCASSLA---GLNQPQHFGDGTRLSI. 111
31 -58.700sp|P01760|HV105_HUMAN Ig heavy chain V-I region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  20  1QVQLMQSGAEVKKPGSSVRVSCKTSTFVDYKGLWVRQAPGKGLEWVGQIPLRFNGPGSVVRVSVSLKPSFNQAHMELSSLFSEDTAVYYCAREYGFDTSDYYYYYWGQGTLVTVS 121
32 -58.700sp|P01761|HV106_HUMAN Ig heavy chain V-I region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  16  1QVQLVQSGAEVKKPGSSVRVTCKTSTFSGYTISWVRQAPGRGLEWVGSPAKWTDPYIKWERVTVSLKPSFNQAYMELVNLFNEDGAVYYCAREWKGQVNVNPFDYWGQGVLVTVS 121
33 -58.600sp|P01769|HV308_HUMAN Ig heavy chain V-III region GA OS=Homo sapiens PE=1 SV=1  ali follow..  25  1QVXLVXSGGGAVXPGRSLRLSCAASSFSTYAMHWVRQAPGKGLXWLSVISYXGXXASVKGRFTISRXXSKXTMYLEMNSLRAENTAVYYCARSGIALGSVAGTDYWGXGTLVTIS 121
34 -58.600sp|P01768|HV307_HUMAN Ig heavy chain V-III region CAM OS=Homo sapiens PE=1 SV=1  ali follow..  19  1QVELVESGGGVVXPGRSLRLSCAASTFSNYAMHWVRQPPGKGLEWVAVISYXGXXXSVKGRFTISRDXSKXTLYLQMNSLRAEXTAVYYCARDRPLYGXYRAFNYWGQGTLVTVS 121
35 -58.500sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  31  3.VMTQSPDSLAVSLGERATINCKSSQSSKNYLAWYQQKPGQPPKLLIYWAS-TRESGVPDRFSGS--GSGTDFTLTISSLQAEDVAVYYCQQYYS------TPYSFGQGTKLEIK 113
36 -58.500sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  32  3.VMTQSPDSLAVSLGERATINCKSSQSNKNYLAWYQQKPGQPPKLLIYWAS-TRESGVPDRFSGS--GSGTDFTLTISSLQAEDVAVYYCQQYDTIP-------TFGGGTKVEIK 112
37 -58.400sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  33  3.VMTQSPVTLSVSPGERATLSCRASQSSNSYLAWYQQKPSGSPRLLIYGAS-TRATGIPARFSGS--GSGTEFTLTISSLQSEDFAVYYCQQYNN------WPPTFGQGTRVEIK 108
38 -58.300sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  33  3.VLTQSPGTLSLSPGERATLSCRASQSSSSYLAWYQQKPGQAPRLLIYGAS-SRATGIPDRFSGS--GSGTDFTLTISRLEPEDFAVYYCQQYGT------SPRTFGQGTKVEIK 108
39 -58.200sp|P01762|HV301_HUMAN Ig heavy chain V-III region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  22  1QVQLVQSGGGLVKPGGSLRLSCVASSFRDFYMSWIRXTPGKGLXWVSYIGGSGSTDSVKGRFTISRDNAQKSLYLXMXSLRTXXTAVYYCAATXXFXWSTFSLXYWGXGXLVTVS 121
40 -58.200sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.VLTQSPGTLSLSPGERATLSCRASQSSNSFLAWYQQKPGQAPRLLIYVAS-SRATGIPDRFSGS--GSGTDFTLTISRLEPEDFAVYYCQQYGS------SPSTFGQGTKVELK 108
41 -58.100sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  27  2..VLTQPPSVSVAPGETARLTCGGNDIGSESVHWYQQKPGQAPVLVIYFDRDRPS-GIPERFSGS--NSGNTATLTISRVEAGDEADYYCQLWD----SSSEHVVFGGGTKLTVL 107
42 -58.100sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  32  3.VLTXSPGTLSLSPGXRAALSCRASQSSGNYLAWYQQKPGQAPRLLMYGVS-SRATGIPDRFSGS--GSGADFTLTISRLXPEDFAVYYCQQYGS------SPFTFGQGSKLEIK 108
43 -58.100sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  31  1QSVLTQPPSVSGTPGQRVTISCSGGSSGNNYVYWYQQLPGTAPKLLIYRDD-KRPSGVPDRFSGS--KSGTSASLAISGLRSEDEAHYHCAAWD----YRLSAVVFGGGTQLTVL 111
44 -58.000sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  22  3FYELTQPPSVSLAAGQTAMITCEGNDIGERSVHWYQQKPGQAPVPVIYDDA-DRPSGVPARFSGY--NSGNSAILTINRVEAGDEADYFCQSWDN----GSYEVVFGTGTMVTVL 110
45 -58.000sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  25  2..VLSQPPSVSVAPGQTARITCGGDGIGGKSVHWYQQKPGQAPVLVVHEDN-DRPAGIPERFSGS--NSGNTAALTISRVEAGDEADYYCEVWD----DRTAHVVFGGGTKLTVL 107
46 -58.000sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  28  3.QMTQSPSSLSATVGDRVTLLCEASQSGNTFLAWYQQKPKKAPKLLIYDAS-NLETGVPSRFSES--GSGTDFTFTISGLXPXXFAVYYCQXYDTLPS------TFGVASKVESK 111
47 -57.900sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  30  3.VMTQSPDSLAVSLGERATINCKSSQSNKNYLAWYQQKPGQPPKLLIYWAS-TRESGVPDRFSGS--GSGTDFTLTISSLQAEDVAVYYCQQYYN------LPWTFGQGTKVEIK 113
48 -57.900sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  33  3.VLTQSPGTLSLSPGERATLSCRASQSSSSYLAWYQQKPGQAPRLLIYGASSRAT-GIPDRFSGS--GSGTDFTLTISRLEPXDFAVYYCQQYGS------SPWTFGQGTKVEIK 108
49 -57.700sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  32  3.VLTQSPGTLSLSPGERATLSCRASQSSNSYLAWYQQKPGQAPRLLIYGAS-SRATGIPDRFSGS--GSGTDFTLTISRLEPDDFAVYYCQQYGS------SPQTFGQGSKVEIK 108
50 -57.600sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  29  1QSVLTQPPSASGTPGGRVTISCSGSSGSNXPAYWYQQLPGTAPKLLIYNYN-QRPSGVPDRFSAS--RSGTSASLAISGLQSEDEADYYCAAWD----DSLDGYVFGTGTKVTVL 111
51 -57.600sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  28  1.SELTQDPAVSVALGQTVRITCQGDSLRGYDAAWYQQKPGQAPLLVIYGRN-NRPSGIPDRFSGS--SSGHTASLTITGAQAEDEADYYCNSRD----SSGKHVLFGGGTKLTVL 107
52 -57.600sp|P01824|HV206_HUMAN Ig heavy chain V-II region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  21  1RLQLQESGPGLVKPSETLSLTCIVSRRTGYYWGWIRQPPGKGLEWIGGVYYTGSIPSLRGRVTISVDTSRNQFSLNLRSMSAADTAMYYCARGNPPPYSDDGIDVWGQGTTVHVS 128
53 -57.500sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  28  7.VMTQSPLSLPVTPGEPASISCRSSQSGYNYLDWYLQKPQQSPQLLIYLGS-NRASGVPDRFSGS--GSGTDFTLKISRVEAEDVGVYYCMQGLQ------TPQTFGQGTKVEIK 116
54 -57.400sp|P01777|HV316_HUMAN Ig heavy chain V-III region TEI OS=Homo sapiens PE=1 SV=1  ali follow..  21  1EVQLVESGGGLVQPGGSLRLSCAASTFSTSAVYWVRQAPGKGLEWVGWRYEGSSLVSVQGRFTISRNDSKNTLYLQMLSLEPXXTAVYYCARVTPAAASLTFSAVWGQGTLVT.. 119
55 -57.300sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.VLTQSPGTLSLSPGERATLSCRAALLSRGYLAWYQQKPGQAPRLLMYGASSRATG-IPDRFSGS--GSGTDFTLTISRLEPEDFAVYYCQQYGS------SPRSFGQGTKVEIK 108
56 -57.300sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  28  3.VLTQSPLSLPVTPGEPASISCRSSQSXGXYLDWYLXKPGXSPXLLIYLGS-NRASGVPNRFSGS--GSGTXFTLKISRVXAXXVGVYYCMQALQ------TPLTFGGGTNVEIK 111
57 -57.300sp|P01817|HV204_HUMAN Ig heavy chain V-II region MCE OS=Homo sapiens PE=1 SV=1  ali follow..  19  1QITLKESGPTLVKPTETLTLTCTFSSTSGVGVGWIRQRPGKALEWLAFINWDDDNPSLRSRLTGTKDTSRNQVVLTITNMDPVDSGTYFCAHRPPWRFTLGGFDXWGQGTLVTVS 124
58 -57.200sp|P01722|LV602_HUMAN Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1  ali follow..  29  1NLMLIQPPSVSESPGKTVTMSCTRTSDASNYVQWYRQRPGGAPTTLIYDTN-QRPYGVPNRFSGSFDSSSNSASLTISGLTNDDTAMYFCQSYDSS-----NLWVFGGGTKLTV. 110
59 -57.200sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  19  1EVQLLESGGGLVQPGGSLRLSCAASTFSSSAMSWVRQAPGKGLEWVAWKYENGNDDSVNGRFTISRNDSKNTLYLLMNSLQAXXTALYYCARDAGPYVSPTFFAHYGQGTLVT.. 119
60 -57.200sp|P06331|HV209_HUMAN(removed signalp:1-20) Ig heavy chain V-II region ARH-77 OS=Homo sapiens PE=4 SV=1  ali follow..  21  1QVQLQQWGAGLVKPSETLSLTCAVFSFSGYYWSWIRQPPGRGLEWIGEINHSGSTTSLKSRVTISLDTSKNLFSLKLSSVTAADTAVYYCARGLLRGGWYYGMDVWGQGTTVTVS 125
61 -57.100sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  30  3.VMTQSPLSLPVTPGEPASISCRSSQSGFDYLNWYLQKPGQSPXLLIYALS-NRASGVPDRFSGS--GSGTDFTLKISRVEAEDVGVYYCMXALQ------APITFGQGTRLEIK 112
62 -57.000sp|P01814|HV201_HUMAN Ig heavy chain V-II region OU OS=Homo sapiens PE=1 SV=1  ali follow..  17  1QVTLTESGPALVKPKQPLTLTCTFSSTSRMRVSWIRRPPGKALEWLARIXXXDKFTSLRTRLSISKNDSKNQVVLIMINVNPVDTATYYCARVVNSVMAGYYMDVWGKGTTVTVS 125
63 -57.000sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  24  1DFMLTQPHSVSESPGKTVIISCTRSDGAGYYVQWYQQRPGRAPTTVIFEDT-QRPSGVPDRFSGSIDRSSNSASLTISGLQTEDEADYYCQSYDR------DHWVFGGGTKLTVL 110
64 -56.900sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  32  3.VLTQSPGTLSLSPGERATLSCRASQSSSGYLGWYQQKPGQAPRLLIYGASSRATG-IPDRFSGS--GSGTDFTLTISRLEPEDFAVYYCQQYGS------LGRTFGQGTKVEIK 108
65 -56.800sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  27  1QSALTQPASVSGSPGQSITISCTGTTGGYDFVSWYQQHPGKAPKLLIYDVN-SRPSGISNRFSGS--KSGNTASLTISGLQAEDEADYYCSSFTT----TNSRAVFGGGTKLSVL 111
66 -56.700sp|P06319|LV605_HUMAN(removed signalp:1-19) Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1  ali follow..  23  1NFMLTQPHSVSESPGKTVTISCTGNSGASNYVQWYQQRRVSAPTIVIYE-DNQRPLGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSFDNTNQG-----VFGGGTKLTVL 111
67 -56.700sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  30  3.VMTQSPLFLPVTLGEPASIQCRSSQSGXTYLXWYLQKPGQSPELLIYLSSYRDS-GVPDRFSDS--GSGTDFTLKITRVQAEDVGVYYCMQATX------SPYTFGQGTKLXIK 112
68 -56.700sp|P01772|HV311_HUMAN Ig heavy chain V-III region KOL OS=Homo sapiens PE=1 SV=1  ali follow..  20  1QVQLVESGGGVVQPGRSLRLSCSSSIFSSYAMYWVRQAPGKGLEWVAIIWDDGSDDSVKGRFTISRDNSKNTLFLQMDSLRPEDTGVYFCARDGGHGFCSSGPDYWGQGTPVTVS 125
69 -56.700sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  29  1QSVLTQPPSVSAAPGQKVTISCSGGSTGNNYVSWHQHLPGTAPKLLIYEDN-KRPSGIPDRISAS--KSGTSATLGITGLRTGDEADYYCATWD----SSLNAVVFGGGTKVTVL 110
70 -56.600sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  25  3.VMTQSPLSLPVTLGQPASISCRSSQSGNTYLNWFQQRPGQSPRRLIYKVS-NRDSGVPDRFSGS--GSGTDFTLKISRVEAEDVGVYYCMQGTH------WSWTFGQGTKVEIK 112
71 -56.600sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  29  2..ALTQPPSVSVSPGQTAVITCSGDNLEKTFVSWFQQRPGQSPLLVIYHTS-ERPSEIPERFSGS--SSGATATLTISGAQSVDEADYFCQTWDT------ITAIFGGGTKLTV. 104
72 -56.600sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  25  2..DLTQPPSVSVSPGQTASITCSGDKLGDKDVCWYQQRPGQSPVLVIYQDN-QRSSGIPERFSGS--NSGNTATLTISGTQAMDEADYYCQAWDS------MSVVFGGGTRLTVL 105
73 -56.600sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  31  1QSVLTQPPSVSAAPGQKVTISCSGSSSGNDYVSWYQQVPGTAPKLLIYDNN-KRPSGIPDRFSGS--KSGTSATLGITGLQTGDEADYYCGTWN----NSLSGWVFGGGTKLTVL 110
74 -56.500sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  32  1QSVLTQPPSVSAAPGQEVTISCSGSSSGDNFVSWYQQLPGTAPKLLIYDNN-KRPSGIPDRFSGS--KSGTSATLGITGLQTGDEADYYCGTWD----SSLSVGMFGGGTRVTVL 110
75 -56.500sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  27  1QSALTQPASVSASPGQSITISCTGTTNSYSYVSWYQQYPGKAPKVLIFDVN-SRPSGVSHRFSGS--KSGNTASLTISGLQAEDEAHYFCSSYRTS-----GTIIFGGGTYVTVL 110

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.