current user: public

If you have questions about the server, please let us know.

Query: sp|P01815|HV202_HUMAN Ig heavy chain V-II region COR OS=Homo sapiens PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst QVTLRESGPALVKPTQTLTLTCTFSGFSLSSTGMCVGWIRQPPGKGLEWLARIDWDDDKYYNTSLETRLTISKDTSRNQVVLTMDPVDTATYYCARITVIPAPAGYMDVWGRGTPVTVSSLast
1 -84.100sp|P01815|HV202_HUMAN Ig heavy chain V-II region COR OS=Homo sapiens PE=1 SV=1  ali  100  1QVTLRESGPALVKPTQTLTLTCTFSGFSLSSTGMCVGWIRQPPGKGLEWLARIDWDDDKYYNTSLETRLTISKDTSRNQVVLTMDPVDTATYYCARITVIPAPAGYMDVWGRGTPVTVSS 120
2 -77.900sp|P01824|HV206_HUMAN Ig heavy chain V-II region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  55  1RLQLQESGPGLVKPSETLSLTCIVSGGPIRRTGYYWGWIRQPPGKGLEWIGGVYYTGSIYYNPSLRGRVTISVDTSRNQFSLNLSAADTAMYYCARGNPPPYYDDGIDVWGQGTTVHVSS 129
3 -77.800sp|P01814|HV201_HUMAN Ig heavy chain V-II region OU OS=Homo sapiens PE=1 SV=1  ali follow..  70  1QVTLTESGPALVKPKQPLTLTCTFSGFSLSTSRMRVSWIRRPPGKALEWLARIXXXDKFYWSTSLRTRLSISKNDSKNQVVLIVNPVDTATYYCARVVNSVMAGYYMDVWGKGTTVTVSS 126
4 -77.600sp|P01817|HV204_HUMAN Ig heavy chain V-II region MCE OS=Homo sapiens PE=1 SV=1  ali follow..  69  1QITLKESGPTLVKPTETLTLTCTFSGFSLSTSGVGVGWIRQRPGKALEWLAFINWDDDNRYSPSLRSRLTGTKDTSRNQVVLTMDPVDSGTYFCAHRPPWRFTLGGFDXWGQGTLVTVSS 125
5 -75.800sp|P01816|HV203_HUMAN Ig heavy chain V-II region DAW OS=Homo sapiens PE=1 SV=1  ali follow..  70  1QVTLRESGPALVRPTQTLTLTCTFSGFSLSGETMCVAWIRQPPGEALEWLAWDILNDDKYYGASLETRLAVSKDTSKNQVVLSVGPGDTATYYCARSCGSQY----FDYWGQGILVTVSS 119
6 -74.400sp|P06331|HV209_HUMAN(removed signalp:1-20) Ig heavy chain V-II region ARH-77 OS=Homo sapiens PE=4 SV=1  ali follow..  51  1QVQLQQWGAGLVKPSETLSLTCAVFGGSFS--GYYWSWIRQPPGRGLEWIGEINHSGSTNYKTSLKSRVTISLDTSKNLFSLKVTAADTAVYYCARGLLRGGWNDVMDVWGQGTTVTVSS 126
7 -73.900sp|P01768|HV307_HUMAN Ig heavy chain V-III region CAM OS=Homo sapiens PE=1 SV=1  ali follow..  48  1QVELVESGGGVVXPGRSLRLSCAASGFTFS--NYAMHWVRQPPGKGLEWVAVISYXGXKYYAXSVKGRFTISRDXSKXTLYLQLRAEXTAVYYCARDRPLYGXYRAFNYWGQGTLVTVSS 122
8 -73.800sp|P01818|HV205_HUMAN Ig heavy chain V-II region HE OS=Homo sapiens PE=1 SV=1  ali follow..  63  1QVTLKENGPTLVKPTETLTLTCTLSGLSLTTDGVAVGWIRQGPGRALEWLAWLLYDDDKRFSPSLKSRLTVTRDTSKNQVVLTMDPVDTATYYCVHRHPRTLA---FDVWGQGTKVAVSS 121
9 -73.800sp|P01769|HV308_HUMAN Ig heavy chain V-III region GA OS=Homo sapiens PE=1 SV=1  ali follow..  46  1QVXLVXSGGGAVXPGRSLRLSCAASGFSFS--TYAMHWVRQAPGKGLXWLSVISYXGXXYYAASVKGRFTISRXXSKXTMYLELRAENTAVYYCARSGIALGSVAGTDYWGXGTLVTISS 122
10 -73.400sp|P01761|HV106_HUMAN Ig heavy chain V-I region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  37  1QVQLVQSGAEVKKPGSSVRVTCKTSGGTFS--GYTISWVRQAPGRGLEWVGSPAKWTDPQGVYIKWERVTVSLKPSFNQAYMELFNEDGAVYYCAREWKGQVNVNPFDYWGQGVLVTVSS 122
11 -73.400sp|P01762|HV301_HUMAN Ig heavy chain V-III region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  44  1QVQLVQSGGGLVKPGGSLRLSCVASGFSFR--DFYMSWIRXTPGKGLXWVSYIGGSGTLYYADSVKGRFTISRDNAQKSLYLXLRTXXTAVYYCAATXXFXWSTFSLXYWGXGXLVTVSS 122
12 -73.400sp|P01760|HV105_HUMAN Ig heavy chain V-I region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  37  1QVQLMQSGAEVKKPGSSVRVSCKTSGGTFV--DYKGLWVRQAPGKGLEWVGQIPLRNGEVKNPGSVVRVSVSLKPSFNQAHMELFSEDTAVYYCAREYGFDTSDYYYYYWGQGTLVTVSS 122
13 -71.800sp|P01772|HV311_HUMAN Ig heavy chain V-III region KOL OS=Homo sapiens PE=1 SV=1  ali follow..  46  1QVQLVESGGGVVQPGRSLRLSCSSSGFIFS--SYAMYWVRQAPGKGLEWVAIIWDDSDQHYADSVKGRFTISRDNSKNTLFLQLRPEDTGVYFCARDGGHGFCSSASCYWGQGTPVTVSS 126
14 -71.700sp|P01744|HV104_HUMAN(removed signalp:1-19) Ig heavy chain V-I region ND (Fragments) OS=Homo sapiens PE=1 SV=2  ali follow..  34  1QTQLVQSGAEVRKPGASVRVSCKASGYTFI--DSYIHWIRQAPGHGLEWVGWINPSGGTNYAPRFQGRVTMTRDASFSTAYMDLRSDDSAVFYCAKSDPFWSDYYNLDVWGQGTTVTVSS 128
15 -71.700sp|P01825|HV207_HUMAN Ig heavy chain V-II region NEWM OS=Homo sapiens PE=1 SV=1  ali follow..  48  1QVQLEQSGPGLVRPSQTLSLTCTVSGSTFS--NDYYTWVRQPPGRGLEWIGYVFYHGTSDDTTPLRSRVTMLVDTSKNQFSLRLTAADTAVYYCARNLIAGC----IDVWGQGSLVTVSS 117
16 -71.700sp|P06326|HV107_HUMAN Ig heavy chain V-I region Mot OS=Homo sapiens PE=1 SV=1  ali follow..  36  1QVQLVQSGAEVKKPGSSARLSCKVSGDDFN--TYDIHWVRQAPGRGLEWMAVVHPDDRTTYGPRSQARFTVTRDSSTTTVYMELISADTAIYYCARGAHYSDTDTSLGPWGQGTLLIVSS 125
17 -71.500sp|P80421|HV108_HUMAN Ig heavy chain V-I region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  35  2.VQLVQSGVERKVPGASVRISCKASGYAFE--NYYIHWVRQAPGLGLEWMGIFNPVAGAVSSEKFRDRLVMSSDTSANTVSMQLRSDDTGRYFCARVSYDFSQ-YGMDVWGQGTTVIVSS 120
18 -71.400sp|P01777|HV316_HUMAN Ig heavy chain V-III region TEI OS=Homo sapiens PE=1 SV=1  ali follow..  44  1EVQLVESGGGLVQPGGSLRLSCAASGFTFS--TSAVYWVRQAPGKGLEWVGWRYGSSLTHYAVSVQGRFTISRNDSKNTLYLQLEPXXTAVYYCARVTPAAASLTFSAVWGQGTLVT... 119
19 -71.300sp|P04438|HV208_HUMAN(removed signalp:1-19) Ig heavy chain V-II region SESS OS=Homo sapiens PE=2 SV=1  ali follow..  75  1QVNLRESGPALVKATHTLTLTCTFSGLSVNTRGMSVSWIRQPPGKALEWLARIDWDDDKYYGTSLETRLTISKDTSKNQVVLKMDPADTATYYCARMQVTMVRSNAFDIWGQGTW..... 123
20 -71.200sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  41  1EVQLLESGGGLVQPGGSLRLSCAASGFTFS--SSAMSWVRQAPGKGLEWVAWKYEGNDKHYADSVNGRFTISRNDSKNTLYLLLQAXXTALYYCARDAGPYVSPTFFAHYGQGTLVT... 119
21 -70.800sp|P01771|HV310_HUMAN Ig heavy chain V-III region HIL OS=Homo sapiens PE=1 SV=1  ali follow..  43  1QVKLVQAGGGVVQPGRSLRLSCIASGFTFS--NYGMHWVRQAPGKGLEWVAVIWYGSRTYYGDSVKGRFTISRDNSKRTLYMXLRTEDTAVYYCARDPDILTAFS-FDYWGQGVLVTVSS 121
22 -70.800sp|P01767|HV306_HUMAN Ig heavy chain V-III region BUT OS=Homo sapiens PE=1 SV=1  ali follow..  45  1EVQLVETGGGLIQPGGSLRLSCAASGFTVS--XHSMSWVRQAPGKALXWVSAIYRGGTTYYADSVKGRFTISRDDSRXTVYLQLRAEDTAVYYCARDLAAA------RLFGKGTTVTVSS 115
23 -70.300sp|P01782|HV321_HUMAN Ig heavy chain V-III region DOB OS=Homo sapiens PE=1 SV=1  ali follow..  41  1EVQLVESGGDLVQPGRSLRLSCAASGFNFH--EYNMHWLRQGPGKGPEWVSTITWNGSVLYADSVKGRFAISRDNAQKTLYLQLRPEDTAFYYCAKGYIWNG--NWFDSWGQGTLVTVSS 120
24 -70.100sp|P01775|HV314_HUMAN Ig heavy chain V-III region LAY OS=Homo sapiens PE=1 SV=1  ali follow..  42  2.VQLLESGGGLVQPGGSLRLSCAASGFTFS--ASAMSWVRQAPGKGLEWVAWKYNGNDKHYADSVNGRFTISRNDSKNTLYLQLQAXVSAIYYCARDAGPYVSPTFFAHWGQGTLVT... 119
25 -70.000sp|P01770|HV309_HUMAN Ig heavy chain V-III region NIE OS=Homo sapiens PE=1 SV=1  ali follow..  46  1QVQLVQSGGGVVQPGRSLRLSCAASGFTFS--RYTIHWVRQAPGKGLEWVAVMSYXGXKHYADSVNGRFTISRNDSKNTLYLNLRPEDTAVYYCARIRDTAMF---FAHWGQGTLVTVSS 119
26 -69.900sp|P01766|HV305_HUMAN Ig heavy chain V-III region BRO OS=Homo sapiens PE=1 SV=1  ali follow..  44  1EVQLVESGGGLVQPGGSLRLSCAASGFTFS--YYNMNWVRQVTGKGLEWVSAIGTAGDQYYADSVKGRFTISRNDSKNTLYLNLRAEDTAVYYCARSPVSLVDYYYGSVWGQGT...... 119
27 -69.000sp|P01742|HV101_HUMAN Ig heavy chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  35  1QVQLVQSGAEVKKPGSSVKVSCKASGGTFS--RSAIIWVRQAPGQGLEWMGGIVPFGPPNYAQKFQGRVTITADESTNTAYMELRSEDTAFYFCAGGYGIYS-----PEEYNGGLVTVSS 117
28 -68.900sp|P01773|HV312_HUMAN Ig heavy chain V-III region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  44  1QVQLVESGGGVVQAGTSLRLSCTASAFNLS--DYAMHWVRQAPGKGLXWVALISYGGXTYYADSVRGRFTISRXISKXTLYLXLRTEDTAVYYCAKLIAVAGT---RXFWGQGTLVTVS. 118
29 -68.000sp|P01781|HV320_HUMAN Ig heavy chain V-III region GAL OS=Homo sapiens PE=1 SV=1  ali follow..  48  1EVQLVESGGDLVQPGRSLRLSCAASGFXFX--XLGMTWVRQAPGKGLEWVANIKXXSXXXYVDSVKGRFTISRDNAKNSLYLQLRVEDTALYYCARGWGGG------DYWGQGTLVTVST 116
30 -68.000sp|P01763|HV302_HUMAN Ig heavy chain V-III region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  47  1QVQLVDSGGGLVEPGGSLRLSCSASGFTFS--ANDMNWVRQAPGKGLEWLSFIGGSGTIYYADSVKGRFTISRNXSKNSLYLQLRAEDTAVYYCARGWL--------LNWGQGTLVTVSS 114
31 -67.700sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1  ali follow..  46  1EVQLLESGGGLVQPGGSLRLSCAASGFTFS--TYVMSWVRQAPGKGLXWVGAIXGLVSXSYAXSVKGRFTISRDDSKNTMN-SLRAEDTAVYYCAKGKVSAYY---FXYWGXGTLVTVSS 115
32 -67.600sp|P01776|HV315_HUMAN Ig heavy chain V-III region WAS OS=Homo sapiens PE=1 SV=1  ali follow..  41  1EVQLLESGGGLVQPGGSLRLSCAASGFSFS--TDAMYWVRQAPGKGLEWVAWKYQEANSHFADTVNGRFTISRNDSKNTLYLQLEAXXTAVYYCARFRQPFV--QFFDVFGQGTLVT... 117
33 -67.500sp|P01778|HV317_HUMAN Ig heavy chain V-III region ZAP OS=Homo sapiens PE=1 SV=1  ali follow..  42  1EVQLVESGGALVQPGGSGRLSCAASGFTFS--TTSRFWVRQAPGKGLEWVEFRVQGSASHYADSVQARFTISRNDSKNTLYLQGEAXXTAVYYCARTRPGGYF---SDVWGQGTLVS... 116
34 -67.500sp|P01779|HV318_HUMAN Ig heavy chain V-III region TUR OS=Homo sapiens PE=1 SV=1  ali follow..  42  1EVQLLESGGGLVQPGGSLRLSCAASGFTFS--RVLSSWVRQAPGKGLEWVSGRLNSSNLHFAVSAQGRFTISRNDSKNTLYLQLQAXXTALYYCARLSVTAVA---FDVWGQGTKVS... 116
35 -67.400sp|P80419|HV322_HUMAN Ig heavy chain V-III region GAR OS=Homo sapiens PE=1 SV=1  ali follow..  46  1EVQLVESGGGLVQPGESLKLSCTASGFSYS--NYVMTWVRQAPGKGLEWVTNIRPDETEKF-YSDSVRFTVSRDNARNSVSNSMRVEDTATYYCARVSDFGDYG--PDFWGQGTLVSVTS 118
36 -67.100sp|P01780|HV319_HUMAN Ig heavy chain V-III region JON OS=Homo sapiens PE=1 SV=1  ali follow..  47  1DVQLVESGGGLVKPGGSLRLSCAASGFTFS--TAWMKWVRQAPGKGLEWVVWRVEVVEKAFANSVNGRFTISRNDSKNTLYLQVTPXXTAVYYCARVVVSTS----MDVWGQGTPVT... 115
37 -64.700sp|P01722|LV602_HUMAN Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1  ali follow..  29  1NLMLIQPPSVSESPGKTVTMSCTRTSDSI--ASNYVQWYRQRPGGAPTTLIYD----TNQRPYGVPNRFSGSFDSSSNSASLTITNDDTAMYFCQSYDSSN-----LWVFGGGTKLTVLS 112
38 -64.200sp|P01721|LV601_HUMAN Ig lambda chain V-VI region AR OS=Homo sapiens PE=1 SV=1  ali follow..  30  1DFMLTQPHSVSESPGKTVTFSCTGSGGSI--ADSFVQWYQQRPGSAPTTVIYD----DNQRPSGVPDRFSGSIDDSANSASLTIKTEDEADYYCQSYNSNH-----HVVFGGGTKVTVLG 112
39 -63.800sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QSVLTQPPSASGTPGQRVTISCSGGNFDI--GRNSVNWYQVHPGTAPRLLIYS----SDQRSSGVPDRFSGSKSGTSASLAISLQSENEADYFCATWDDSLD----GPVFGGGTKVTVLG 111
40 -63.600sp|A6NJ16|VSIG6_HUMAN(removed signalp:1-19) Putative V-set and immunoglobulin domain-containing protein 6 OS=Homo sapiens GN=VSIG6 PE=5 SV=2  ali follow..  52  1QVQLQESGPGLVKPSETLSLTCVVSGGSIS-SSNWWSWVRQPPGKGLEWIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLTAADRAVYYCARDTVRGG.................. 104
41 -63.500sp|P06319|LV605_HUMAN(removed signalp:1-19) Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1  ali follow..  25  1NFMLTQPHSVSESPGKTVTISCTGNSGSI--ASNYVQWYQQRRVSAPTIVIYE----DNQRPLGVPDRFSGSIDSSSNSASLTIKTEDEADYYCQSFDNTN-----QGVFGGGTKLTVLG 112
42 -63.100sp|P06318|LV604_HUMAN Ig lambda chain V-VI region WLT OS=Homo sapiens PE=1 SV=1  ali follow..  27  1NFMLTQPLSVSGSPEKTVTISCTGSSGSI--GSNYVQWYQQRPGSAPTNVIYE----NNQRPSEVPDRFSGSIDSSSNSASLTIKTEDEADYYCQSYDNNN------HVVFGGTRLTVLG 111
43 -62.800sp|P12018|VPREB_HUMAN(removed signalp:1-19) Immunoglobulin iota chain OS=Homo sapiens GN=VPREB1 PE=1 SV=2  ali follow..  26  1QPVLHQPPAMSSALGTTIRLTCTLRN-DHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSIQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAAR 122
44 -62.500sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  26  1QSALTQPASVSGSPGQSITISCTGTTSDVG-SYNFVSWYQQNPGKAPKLMIYE----GNKRPSGVSNRFSGSKSGKTASLTISLQVEDEADYYCCSYAGNS-----TRVFGGGTRVTVLS 111
45 -62.500sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QSALTQPPSASGSPGQSVTISCTGTSSDVG-DNKYVSWYQQHPGRAPKLVIFE----VSQRPSGVPDRFSGSKSDNTASLTVSLRAEDEADYYCSSYVDNNNF-----VFGGGTKLTVLR 111
46 -62.200sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  25  1QSVLTQPPSVSAAPGQEVTISCSGSSSNI--GDNFVSWYQQLPGTAPKLLIYD----NNKRPSGIPDRFSGSKSGTSATLGITLQTGDEADYYCGTWDSSLSV----GMFGGGTRVTVLG 111
47 -62.100sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  27  1DFMLTQPHSVSESPGKTVIISCTRSDGTIA--GYYVQWYQQRPGRAPTTVIFE----DTQRPSGVPDRFSGSIDRSSNSASLTIQTEDEADYYCQSYDRDH------WVFGGGTKLTVLG 111
48 -61.900sp|Q9UKI3|VPRE3_HUMAN(removed signalp:1-23) Pre-B lymphocyte protein 3 OS=Homo sapiens GN=VPREB3 PE=2 SV=1  ali follow..  28  1.....QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTIQPEDDADYYCSVGYGFS................... 99
49 -61.900sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  25  1QSALTQPASVSASPGQSITISCTGTTNDIG-SYSYVSWYQQYPGKAPKVLIF----DVNSRPSGVSHRFSGSKSGNTASLTISLQAEDEAHYFCSSYRTSGTI-----IFGGGTYVTV.. 109
50 -61.700sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  28  1QSVLTQPPSASGTPGQRVTISCFGSSSNI--GRYYVYWYQQLPGTTPKLLIYK----DNQRPSGVPDRFSGSKSGTSASLAISLRSEDEADYYCAAWDDS------LWVFGGGTTLTVLS 109
51 -61.700sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  25  1QSVLTQPPSVSAAPGQKVTISCSGSSSNI--GNDYVSWYQQVPGTAPKLLIYD----NNKRPSGIPDRFSGSKSGTSATLGITLQTGDEADYYCGTWNNSLSG----WVFGGGTKLTVLG 111
52 -61.500sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  26  1QSVLTQPPSVSAAPGQKVTISCSGGSTNI--GNNYVSWHQHLPGTAPKLLIYE----DNKRPSGIPDRISASKSGTSATLGITLRTGDEADYYCATWDSSLNA----VVFGGGTKVTVLG 111
53 -61.200sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QSALTQPRSVSGSPGQSVTISCAGTS-SDVGGNHFVSWYQQHPGKAPKLIIY----GVNKRPSGVPYRFSGSKSGNTASLTISLQAEDEAHYYCCSYAGRF-----TWVFGGGTNLTVLG 111
54 -61.200sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QSALTQPRSVSGSPGQSVTISCTGTSSDVG-AYNSVSWYQQHPGKAPKLMIFD----VTKRPSGVPDRLSGSKSGDTASLTISLRADDEADYYCCSYAGRYSV-----IFGGGTKLTVLG 111
55 -61.100sp|P01708|LV205_HUMAN Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  22  1QSALTQPRSVSGSPGHSVTISCIGTSSNVG-DYKYVSWYQQHPGKAPKLIIYE----VSSRPSGVPDRFSGSKSGNTASLTISLQAEDEADYYCCSYIGS-------YVFGTGTKVIVLG 109
56 -60.800sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  23  1QSALTQPPRVSGSPGQSVTISCTGSYSNVT-GYNHVSWYQQDPGKVPKLMIYDVD----KRPSGVPDRFSGSKSANTASLTISLQANNEADYYCSSYGGTYSL-----IFGGGTKLTVLG 111
57 -60.800sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  25  1QSALTQPASVSGSPGQSITISCTGTTSDVG-GYDFVSWYQQHPGKAPKLLIYD----VNSRPSGISNRFSGSKSGNTASLTISLQAEDEADYYCSSFTTTNSR-----VFGGGTKLSVLG 112
58 -60.700sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QSALTQPPSASGSLGQSVTISCTGTSSDVG-GYNYVSWYQQHAGKAPKVIIYEVN----KRPSGVPDRFSGSKSGNTASLTVSLQAEDEADYYCSSYEGSDNF-----VFGTGTKVTVLG 111
59 -60.600sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  24  1QSVLTQPPSASGTPGGRVTISCSGSSSNVG-SNXPAYWYQQLPGTAPKLLIYNYN----QRPSGVPDRFSASRSGTSASLAISLQSEDEADYYCAAWDDSLDG----YVFGTGTKVTVLR 112
60 -60.500sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  25  1QSVLTQPPSLSAAPGQRVSISCSGSSSNI--GKNYVDWYQQLPGTAPKLLIFN----NNKRPSGIPDRFSGSKSGTSATLGITLQTGDEAIYYCGTWDNRR------SVFGGGTNVTVVG 109
61 -60.500sp|A6NDP1|VSIG7_HUMAN(removed signalp:1-19) Putative V-set and immunoglobulin domain-containing protein 7 OS=Homo sapiens GN=VSIG7 PE=5 SV=1  ali follow..  33  1QVQLMQSGAEVKKPGASVRISCKASGYTFT--SYCMHWVCQAHAQGLEWMGLVCPDGSTSYAQKFQGRVTITRDTSMGTAYMELRSEDTAMYYCVRDTM..................... 101
62 -60.500sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  21  1DIQMTQSPSLSATVGDRVTLLCEASQSVLESGNTFLAWYQQKPKKAPKLLIYD----ASNLETGVPSRFSESGSGTDFTFTISLXPXXFAVYYCQXYDTLP------STFGVASKVESK. 111
63 -60.400sp|A6NJS3|VSIGL_HUMAN(removed signalp:1-19) Putative V-set and immunoglobulin domain-containing-like protein ENSP00000303034 OS=Homo sapiens PE=5 SV=1  ali follow..  33  1QVQLVQSGAEVKKPGASVKVSCKASGYTIT--SYCMHWVHQVHAQGLEWMGLVCPDGSTSYAQKFQARVTITRDTSMSTAYMELRSEDTAMYYCVRDTM..................... 101
64 -60.300sp|P01764|HV303_HUMAN(removed signalp:1-19) Ig heavy chain V-III region VH26 OS=Homo sapiens PE=1 SV=1  ali follow..  45  1EVQLLESGGGLVQPGGSLRLSCAASGFTFS--SYAMSWVRQAPGKGLEWVSAISGGGSTYYGDSVKGRFTISRDNSKNTLYLQLRAEDTAVYYCAK........................ 98
65 -60.200sp|P23083|HV103_HUMAN(removed signalp:1-19) Ig heavy chain V-I region V35 OS=Homo sapiens PE=1 SV=1  ali follow..  36  1QVQLVQSGAEVKKPGASVKVSCKASGYTFT--GYYMHWVRQAPGQGLEWMGRINPSGGTNYAQKFQGRVTSTRDTSISTAYMELRSDDTVVYYCAR........................ 98
66 -60.100sp|P01743|HV102_HUMAN(removed signalp:1-19) Ig heavy chain V-I region HG3 OS=Homo sapiens PE=4 SV=1  ali follow..  36  1QVQLVQSGAEVKKPGASVKVSCKASGYTFN--SYYMHWVRQAPGQGLEWMGIINPGGSTSYAQKFQGRVTMTRDTSTSTVYMELRSEDTAVYYCAR........................ 98
67 -60.100sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  22  1HSALTQPASVSGSLGQSITISCTGTSSDVG-GYNYVSWFQQHPGTAPKLIISEVR----NRPSGVSDRFSGSKSANTASLTISLQAEDEADYYCSSYTSSNSV-----VFGGGTKLTVLG 111
68 -59.700sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  25  1QSVLTQPPSVSGTPGQRVTISCSGGS-SNGTGNNYVYWYQQLPGTAPKLLIYR----DDKRPSGVPDRFSGSKSGTSASLAISLRSEDEAHYHCAAWDYRLSA----VVFGGGTQLTVLR 112
69 -58.600sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  21  3FYELTQPPSVSLAAGQTAMITCEGN----DIGERSVHWYQQKPGQAPVPVIYD----DADRPSGVPARFSGYNSGNSAILTINVEAGDEADYFCQSWDNGSYE----VVFGTGTMVTVLG 111
70 -58.500sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.SELTQDPAVSVALGQTVRITCQGD----SLRGYDAAWYQQKPGQAPLLVIY----GRNNRPSGIPDRFSGSSSGHTASLTITAQAEDEADYYCNSRDSSGKH----VLFGGGTKLTVLG 108
71 -58.400sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  23  1QSALTQPRSVSGSPGQSLTISCSGAPCDVD-GCESVSWYQQHPGKAPKLIIYGFS----NRPSGVPLRFSGSKSGDAASLTISLQVEDEADYYCSSYADSS-------IFGAGTKLTVLR 110
72 -57.900sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  21  1DIVMTQSPSLAVSLGERATINCKSSQSVLSNNKNYLAWYQQKPGQPPKLLIYW----ASTRESGVPDRFSGSGSGTDFTLTISLQAEDVAVYYCQQYDTI-------PTFGGGTKVEIK. 112
73 -57.500sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  24  1XIVLTXSPTLSLSPGXRAALSCRASQ---SLSGNYLAWYQQKPGQAPRLLMYG----VSSRATGIPDRFSGSGSGADFTLTISLXPEDFAVYYCQQYGSSP------FTFGQGSKLEIK. 108
74 -57.300sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  27  3..ALTQPRSLSGSPGQAVTISCTGLP-SVVDDDNFVSWYQQTPGRAPRLLIYD----DSLRPSGVPNRFSGSKSDTKAALTISLQPDDEATYFCCSYVG-----NYIFVFGQGTDLTVLG 111
75 -57.000sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  23  1EIVMTQSPTLSVSPGERATLSCRASQ---SISNSYLAWYQQKPSGSPRLLIYG----ASTRATGIPARFSGSGSGTEFTLTISLQSEDFAVYYCQQYNNWP------PTFGQGTRVEIK. 108

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.