current user: public

If you have questions about the server, please let us know.

Query: sp|P02774|VTDB_HUMAN(removed signalp:1-16) Vitamin D-binding protein OS=Homo sapiens GN=GC PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .
# Score Template Links and tools%idFirst LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPKELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNILLast
1 -147.000sp|P02774|VTDB_HUMAN(removed signalp:1-16) Vitamin D-binding protein OS=Homo sapiens GN=GC PE=1 SV=1  ali  100  1LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPKELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL 458
2 -97.000sp|P43652|AFAM_HUMAN(removed signalp:1-19) Afamin OS=Homo sapiens GN=AFM PE=1 SV=1  ali follow..  18  1LTLPTQPRDIENFNSTQKFIEDNIEYITIIAFAQYVQEATFEEMEKLVKDMVEYKDRCMADKTLPECSKLPNNVLQEKICAMEG-LPQKHNFSHCCSKVDAQRRLCFFYNKKSDVFLPPFPTLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCEEQNKVNCLQTRAIPVTQLKAFSSYQKHVCGALLKFGTKVVHFIYIAILSQKFPKIEFKELISLVEDVSSNYDGCCEGDVVQCIRDTSK-VMNHICSKQDSISSKIKECCEKKIP-ERGQCIINSNKDDRPKLREGKFTDSENVCQERDADPDTFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGEL. 463
3 -94.800sp|P02768|ALBU_HUMAN(removed signalp:1-18) Serum albumin OS=Homo sapiens GN=ALB PE=1 SV=2  ali follow..  20  4..FRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDERDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADD-RADLAKYICENQDSISSKLKECCE-KPLLEKSHCIAEVENDEMPASLAADFVESKDVCKNYAEAKDVFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRCAEDYLSVVLNQL. 466
4 -89.000sp|P02771|FETA_HUMAN(removed signalp:1-18) Alpha-fetoprotein OS=Homo sapiens GN=AFP PE=1 SV=1  ali follow..  18  4..HRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKE-ILEKYGHSDCCSQSEEGRHNCFLAHKKPPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVKELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCL-QDGEKIMSYICSQQDTLSNKITECCKLTTL-ERGQCIIHAENDEKPEGLSPNFLGDRDFNQGEKNIFLASFVHEYSRRHPLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLCGEGAADIIIGHLC 467
5 -36.100sp|Q16610|ECM1_HUMAN(removed signalp:1-19) Extracellular matrix protein 1 OS=Homo sapiens GN=ECM1 PE=1 SV=2  ali follow..  12  173................................PWNLPQSSYSHLTRQGETLNFLYSRCCHHTNRLECAKLVWEEAMSRFCEAEF--SVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRLPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRE--LLALIQLEREFQRCCRQGNNHTCTWKAWEDTDREYAVKTHHHLCCRHPPSPTRRDILTIDIGRVTPNLMGHLCGNQRVLTKHIHNMTARCCFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNAKGQGEQGSTGGTNISSTSEPKE.................................................................................................................................... 520
6 -11.400sp|O75445|USH2A_HUMAN(removed signalp:1-31) Usherin OS=Homo sapiens GN=USH2A PE=1 SV=3  ali   10  4.....................................................................................................................................................................YSSEAKVCCNGVLYNPKPGHRCCEEKYIPFVLNSTGVCCG------------------GRIQEAQPNHQCCSGYYARILPGEVCCPDEQHNCGRMPYSTSGNQICCAGRLHDGHGQKCCGRQIVSNDLECCGGEEGVVYNRLPGMFCCGQDYVNMSDTICCSASSGESKAHIKKNDPVPVKCCETELIPKSQKCCNNPLKYVCSDKISTGMMMKLCPASMEATEHCGR---------------------------------CDFNFTSHICTVIR.................. 248
7 -10.000sp|P98088|MUC5A_HUMAN(removed signalp:1-27) Mucin-5AC (Fragments) OS=Homo sapiens GN=MUC5AC PE=1 SV=3  ali   10  35.......................................................GQCCPQ----SCACNTSRCPAPVGCPEGARAIPTYQEGACCPVQNCSWTVCSINGTLYQPGAVVSSSLCETCRCELPGGPPSDA-------FVVSCETQICNTHCPVGFEYQEQSGQCCGTCVQVACVTNTSKSPAHLFETWSDAGNHCVTHQCEKHQD-------GLVVVTTKKACPPLSCSLDEARMSKDGCCR----FCPLPPPPYQNQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHR-----------------------------------------QCCQELRTSLCTDGSS..................................................................................... 300
8 -9.650sp|Q3ZCN5|CL064_HUMAN Uncharacterized protein C12orf64 OS=Homo sapiens GN=C12orf64 PE=2 SV=4  ali   8.......................................................DCGCIQ----LCEKDD---------------------------------VCVFQEVSVLNPGQSMIKYLEEDFCYAIECLEEKDNHTGFHTLNFTLVNCSKKCDVHQVYTPSPSDYGCCGTCKNVSCKFHMENGTSVVYAVGSTWHYNCTTYECVKTDE--GAIILNYTMVCPPFNETECKMNEGIVKLYNEGCCKICKRE----------ERICQKVIIKSVIRKQDCMSQSPINVASCDGKCPSATIYNINIESHLRFCKCCRENGVRNLSVPLYCSGNGTEIMYTLQ---------EPIDCCQWN............................................................................................... 259
9 -9.560sp|Q6ZRI0|OTOGL_HUMAN(removed signalp:1-22) Otogelin OS=Homo sapiens GN=OTOG PE=2 SV=3  ali   13  63.......................................................DRCCPYKS--ECDCDTIPVPRCHLSQLDEEFMHSVENVCGCAKY-VKAPVCLSRELGVMQPGQTVVELSADGVCHTSRCTTVLDPLTNFYQINTTSVLCDIHCEANQEYEHPRDLAACCGSCRNVSCLFTFPNGTTSLFLPGASWIADCARHHCSSTPL--GAVLVRSPISCPPLNETECAKVGGSVVPSLEGCCRTDGRSCKKVTIRMTIRK-CRSSTPV--NLVSCCPSA........................................................................................................................................................................... 300
10 -9.290sp|P04275|VWF_HUMAN(removed signalp:1-22) von Willebrand factor OS=Homo sapiens GN=VWF PE=1 SV=4  ali   11  4.......................................................QPCCLSGRKVNCTTQPCPTAKAPTCGLCEVARLRQNADQCC---------------------PEYECVCDPVSCDL-----------------------PPVPHCERGLQPTLTNPGECRPNFTCAC-----------------RKEECKRVSPPSCPP------------------------HRLPTLRKTQCCDEYECACNCVNSTVSCPL--GYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTDMEDAVMGLRVAQCSQKPCEDS------CRSGFTYVLHEGECCGRCLPSACEVVTGSPRGDSVGSQWASPENPCLINE---VRVKEEVFIQQRNVSCPQLEVPVCPS-GFQLSCKTSACC..................... 299

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.