current user: public

If you have questions about the server, please let us know.

Query: sp|P03979|TVC_HUMAN(removed signalp:1-17) T-cell receptor gamma chain V region PT-gamma-1/2 OS=Homo sapiens GN=TRGV3 PE=2 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst KSSNLEGRTKSVTRQTGSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDVSTARDVLESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRXKNYYKKLFGSGTTLVVTLast
1 -81.000sp|P03979|TVC_HUMAN(removed signalp:1-17) T-cell receptor gamma chain V region PT-gamma-1/2 OS=Homo sapiens GN=TRGV3 PE=2 SV=1  ali  100  1KSSNLEGRTKSVTRQTGSSAEITCDLTVTNTFYIHWYLHQEGKAPQRLLYYDVSTARDVLESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRXKNYYKKLFGSGTTLVVT 119
2 -69.000sp|P01782|HV321_HUMAN Ig heavy chain V-III region DOB OS=Homo sapiens PE=1 SV=1  ali follow..  18  1..EVQLVESGGDLVQPGRSLRLSCAASGFHEYNMHWLRQGPGKGPEWVSTITWNGGSVLYADSVKGRFAISRDNAQKTLYLQLNILRPEDTAFYYCAKGYIWNGNWFDSWGQGTLVTVS 119
3 -66.700sp|P06326|HV107_HUMAN Ig heavy chain V-I region Mot OS=Homo sapiens PE=1 SV=1  ali follow..  23  1..QVQLVQSGAEVKKPGSSARLSCKVSGDNTYDIHWVRQAPGRGLEWMAVVHPSDDRTTYGPRSQARFTVTRDSSTTTVYMELTALISADTAIYYCARGAHYSDTSLGPWGQGTLLIVS 124
4 -66.700sp|P01772|HV311_HUMAN Ig heavy chain V-III region KOL OS=Homo sapiens PE=1 SV=1  ali follow..  16  1..QVQLVESGGGVVQPGRSLRLSCSSSGFSSYAMYWVRQAPGKGLEWVAIIWDDGSDQHYADSVKGRFTISRDNSKNTLFLQMDSLRPEDTGVYFCARDGGHGFCGPDYWGQGTPVTVS 125
5 -66.700sp|P01776|HV315_HUMAN Ig heavy chain V-III region WAS OS=Homo sapiens PE=1 SV=1  ali follow..  16  1..EVQLLESGGGLVQPGGSLRLSCAASSFSTDAMYWVRQAPGKGLEWVAWKYQEASNSHFADTVNGRFTISRNDSKNTLYLQMNRLEAXXTAVYYCARFRQPFVQFFDVFGQGTLVT.. 117
6 -66.100sp|P01771|HV310_HUMAN Ig heavy chain V-III region HIL OS=Homo sapiens PE=1 SV=1  ali follow..  16  1..QVKLVQAGGGVVQPGRSLRLSCIASGFSNYGMHWVRQAPGKGLEWVAVIWYNGSRTYYGDSVKGRFTISRDNSKRTLYMXMNSLRTEDTAVYYCARDPDILTAFFDYWGQGVLVTVS 120
7 -66.000sp|P01768|HV307_HUMAN Ig heavy chain V-III region CAM OS=Homo sapiens PE=1 SV=1  ali follow..  16  1..QVELVESGGGVVXPGRSLRLSCAASGFSNYAMHWVRQPPGKGLEWVAVISYXGXXKYYAXSVKGRFTISRDXSKXTLYLQMNSLRAEXTAVYYCARDRPLYGXYRNYWGQGTLVTVS 121
8 -65.800sp|P01770|HV309_HUMAN Ig heavy chain V-III region NIE OS=Homo sapiens PE=1 SV=1  ali follow..  18  1..QVQLVQSGGGVVQPGRSLRLSCAASGFSRYTIHWVRQAPGKGLEWVAVMSYXGXXKHYADSVNGRFTISRNDSKNTLYLNMNSLRPEDTAVYYCARIRD-TAMFFAHWGQGTLVTVS 118
9 -65.700sp|P01760|HV105_HUMAN Ig heavy chain V-I region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  20  1..QVQLMQSGAEVKKPGSSVRVSCKTSGGVDYKGLWVRQAPGKGLEWVGQIPLRFNGEVKNPGSVVRVSVSLKPSFNQAHMELSSLFSEDTAVYYCAREYGFDTYYYYYWGQGTLVTVS 121
10 -65.700sp|P01761|HV106_HUMAN Ig heavy chain V-I region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  18  1..QVQLVQSGAEVKKPGSSVRVTCKTSGGSGYTISWVRQAPGRGLEWVGSPAKWTDPFQGVYIKWERVTVSLKPSFNQAYMELVNLFNEDGAVYYCAREWKGQVNVNDYWGQGVLVTVS 121
11 -65.700sp|P01769|HV308_HUMAN Ig heavy chain V-III region GA OS=Homo sapiens PE=1 SV=1  ali follow..  17  1..QVXLVXSGGGAVXPGRSLRLSCAASGFSTYAMHWVRQAPGKGLXWLSVISYXGXXXYYAASVKGRFTISRXXSKXTMYLEMNSLRAENTAVYYCARSGIALGSVTDYWGXGTLVTIS 121
12 -65.600sp|P80419|HV322_HUMAN Ig heavy chain V-III region GAR OS=Homo sapiens PE=1 SV=1  ali follow..  18  1..EVQLVESGGGLVQPGESLKLSCTASGFSNYVMTWVRQAPGKGLEWVTNIRPDETE--KFYSDSVRFTVSRDNARNSVSNSMFLQRVEDTATYYCARVSDFGDYGPDFWGQGTLVSVT 117
13 -65.500sp|P01762|HV301_HUMAN Ig heavy chain V-III region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  19  1..QVQLVQSGGGLVKPGGSLRLSCVASSFRDFYMSWIRXTPGKGLXWVSYIGGSGSTLYYADSVKGRFTISRDNAQKSLYLXMXSLRTXXTAVYYCAATXXFSTFSLXYWGXGXLVTVS 121
14 -65.500sp|P01818|HV205_HUMAN Ig heavy chain V-II region HE OS=Homo sapiens PE=1 SV=1  ali follow..  17  1..QVTLKENGPTLVKPTETLTLTCTLSTTDGVAVGWIRQGPGRALEWLAWLLYWDDDKRFSPSLKSRLTVTRDTSKNQVVLTMTNMDPVDTATYYCVHRHPRTLA-FDVWGQGTKVAVS 120
15 -65.500sp|P01773|HV312_HUMAN Ig heavy chain V-III region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  17  1..QVQLVESGGGVVQAGTSLRLSCTASAFSDYAMHWVRQAPGKGLXWVALISYGGSXTYYADSVRGRFTISRXISKXTLYLXMKTLRTEDTAVYYCAKLIAVAGTR-XFWGQGTLVTVS 118
16 -65.400sp|P01744|HV104_HUMAN(removed signalp:1-19) Ig heavy chain V-I region ND (Fragments) OS=Homo sapiens PE=1 SV=2  ali follow..  20  1..QTQLVQSGAEVRKPGASVRVSCKASGYIDSYIHWIRQAPGHGLEWVGWINPNSGGTNYAPRFQGRVTMTRDASFSTAYMDLRSLRSDDSAVFYCAKSDPFWSDTLDVWGQGTTVTVS 127
17 -64.800sp|P01781|HV320_HUMAN Ig heavy chain V-III region GAL OS=Homo sapiens PE=1 SV=1  ali follow..  17  1..EVQLVESGGDLVQPGRSLRLSCAASGFXXLGMTWVRQAPGKGLEWVANIKXXGSXXXYVDSVKGRFTISRDNAKNSLYLQMNSLRVEDTALYYCARGWGGGD----YWGQGTLVTVS 115
18 -64.700sp|P01742|HV101_HUMAN Ig heavy chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  13  1..QVQLVQSGAEVKKPGSSVKVSCKASGGSRSAIIWVRQAPGQGLEWMGGIVPMFGPPNYAQKFQGRVTITADESTNTAYMELSSLRSEDTAFYFCAGGYGIYSP---EEYNGGLVTVS 116
19 -64.500sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  27  2.TFYELTQPPSVSLAAGQTAMITCEGNDIGERSVHWYQQKPGQAPVPVIYDDADRPSGVPA-------RFSGYNSGNSAILTINRVEAGDEADYFCQSWDN--GSYEVVFGTGTMVTVL 110
20 -63.700sp|P06331|HV209_HUMAN(removed signalp:1-20) Ig heavy chain V-II region ARH-77 OS=Homo sapiens PE=4 SV=1  ali follow..  17  1..QVQLQQWGAGLVKPSETLSLTCAVFSFSGYYWSWIRQPPGRGLEWIGEINHSGST-NYKTSLKSRVTISLDTSKNLFSLKLSSVTAADTAVYYCARGLLRGGWGMDVWGQGTTVTVS 125
21 -63.700sp|P01817|HV204_HUMAN Ig heavy chain V-II region MCE OS=Homo sapiens PE=1 SV=1  ali follow..  19  1..QITLKESGPTLVKPTETLTLTCTFSSTSGVGVGWIRQRPGKALEWLAFINWDDDN-RYSPSLRSRLTGTKDTSRNQVVLTITNMDPVDSGTYFCAHRPPWRLGGFDXWGQGTLVTVS 124
22 -63.600sp|P01778|HV317_HUMAN Ig heavy chain V-III region ZAP OS=Homo sapiens PE=1 SV=1  ali follow..  16  1..EVQLVESGGALVQPGGSGRLSCAASGFSTTSRFWVRQAPGKGLEWVEFRVQGSAISHYADSVQARFTISRNDSKNTLYLQMNTGEAXXTAVYYCARTRP-GGYFSDVWGQGTLVS.. 116
23 -63.600sp|P01777|HV316_HUMAN Ig heavy chain V-III region TEI OS=Homo sapiens PE=1 SV=1  ali follow..  15  1..EVQLVESGGGLVQPGGSLRLSCAASGFSTSAVYWVRQAPGKGLEWVGWRYEGSSLTHYAVSVQGRFTISRNDSKNTLYLQMLSLEPXXTAVYYCARVTPAAATFSAVWGQGTLVT.. 119
24 -63.500sp|P01763|HV302_HUMAN Ig heavy chain V-III region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  18  1..QVQLVDSGGGLVEPGGSLRLSCSASGFSANDMNWVRQAPGKGLEWLSFIGGSGSTIYYADSVKGRFTISRNXSKNSLYLQMSSLRAEDTAVYYCARGWL------LNWGQGTLVTVS 113
25 -63.400sp|P01814|HV201_HUMAN Ig heavy chain V-II region OU OS=Homo sapiens PE=1 SV=1  ali follow..  19  1..QVTLTESGPALVKPKQPLTLTCTFSSTSRMRVSWIRRPPGKALEWLARIXXXDKF-YWSTSLRTRLSISKNDSKNQVVLIMINVNPVDTATYYCARVVNSVMYYMDVWGKGTTVTVS 125
26 -63.400sp|P80421|HV108_HUMAN Ig heavy chain V-I region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  20  1..AVQLVQSGVERKVPGASVRISCKASGYENYYIHWVRQAPGLGLEWMGIFNPVAGA-VSSEKFRDRLVMSSDTSANTVSMQLRNLRSDDTGRYFCARVSYDSQYGMDVWGQGTTVIVS 119
27 -63.200sp|P01824|HV206_HUMAN Ig heavy chain V-II region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  17  1..RLQLQESGPGLVKPSETLSLTCIVSRRTGYYWGWIRQPPGKGLEWIGGVYYTGSI-YYNPSLRGRVTISVDTSRNQFSLNLRSMSAADTAMYYCARGNPPSDDGIDVWGQGTTVHVS 128
28 -63.200sp|P01780|HV319_HUMAN Ig heavy chain V-III region JON OS=Homo sapiens PE=1 SV=1  ali follow..  14  1..DVQLVESGGGLVKPGGSLRLSCAASGFSTAWMKWVRQAPGKGLEWVVWRVEQVVEKAFANSVNGRFTISRNDSKNTLYLQMISVTPXXTAVYYCARVVV--STSMDVWGQGTPVT.. 115
29 -63.100sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  14  1..EVQLLESGGGLVQPGGSLRLSCAASGFSSSAMSWVRQAPGKGLEWVAWKYENGNDKHYADSVNGRFTISRNDSKNTLYLLMNSLQAXXTALYYCARDAGPYVTFFAHYGQGTLVT.. 119
30 -63.100sp|P01825|HV207_HUMAN Ig heavy chain V-II region NEWM OS=Homo sapiens PE=1 SV=1  ali follow..  16  1..QVQLEQSGPGLVRPSQTLSLTCTVSGSSNDYYTWVRQPPGRGLEWIGYVFYHGTS-DDTTPLRSRVTMLVDTSKNQFSLRLSSVTAADTAVYYCARNLI--AGCIDVWGQGSLVTVS 116
31 -63.100sp|P01816|HV203_HUMAN Ig heavy chain V-II region DAW OS=Homo sapiens PE=1 SV=1  ali follow..  15  1..QVTLRESGPALVRPTQTLTLTCTFSSGETMCVAWIRQPPGEALEWLAWDILNDDK-YYGASLETRLAVSKDTSKNQVVLSMNTVGPGDTATYYCARSCG--SQYFDYWGQGILVTVS 118
32 -63.000sp|P01779|HV318_HUMAN Ig heavy chain V-III region TUR OS=Homo sapiens PE=1 SV=1  ali follow..  14  1..EVQLLESGGGLVQPGGSLRLSCAASGFSRVLSSWVRQAPGKGLEWVSGRLNASSNLHFAVSAQGRFTISRNDSKNTLYLQMLSLQAXXTALYYCARLSV-TAVAFDVWGQGTKVS.. 116
33 -62.900sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  22  1...SELTQDPAVSVALGQTVRITCQGDSLRGYDAAWYQQKPGQAPLLVIYGRNNRPSGIPD-------RFSGSSSGHTASLTITGAQAEDEADYYCNSRDS--SGKHVLFGGGTKLTVL 107
34 -62.800sp|P01737|TVA3_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region PY14 OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..QSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATL----VKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSDLEPNSSKIIFGSGTRLSI. 114
35 -62.500sp|P04437|TVA2_HUMAN(removed signalp:1-21) T-cell receptor alpha chain V region CTL-L17 OS=Homo sapiens GN=TCRA PE=2 SV=1  ali follow..  23  6.DQQVKQNSPSLSVQEGRISILNCDYTNSMFDYFLWYKKYPAEGPTFLISISSIKDK-----NEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAAKGAGTAS-KLTFGTGTRLQVT 117
36 -62.300sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  25  2....VLTQPPSVSVAPGETARLTCGGNDIGSESVHWYQQKPGQAPVLVIYFDRDRPSGI-------PERFSGSNSGNTATLTISRVEAGDEADYYCQLWDS--SSEHVVFGGGTKLTVL 107
37 -62.100sp|P01775|HV314_HUMAN Ig heavy chain V-III region LAY OS=Homo sapiens PE=1 SV=1  ali follow..  14  1..AVQLLESGGGLVQPGGSLRLSCAASGFSASAMSWVRQAPGKGLEWVAWKYENGNDKHYADSVNGRFTISRNDSKNTLYLQMNGLQAXVSAIYYCARDAGPYVTFFAHWGQGTLVT.. 119
38 -62.000sp|P01722|LV602_HUMAN Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1  ali follow..  24  1..NLMLIQPPSVSESPGKTVTMSCTRTSDASNYVQWYRQRPGGAPTTLIYDTNQRPY-----GVPNRFSGSFDSSSNSASLTISGLTNDDTAMYFCQSYDS---SNLWVFGGGTKLTVL 111
39 -62.000sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  19  3...VMTQSPATLSVSPGERATLSCRASQSVSNNLAWYQQKPGQPPRLLIYGASTRATGIPA-------RFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNWP---PWTFGQGTRVEIK 108
40 -61.900sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  23  3...QMTQSPSSLSASVGDRVIITCRASQSSVDYLNWYQQKPGKAPKLLIFDTSNLQSGVPS-------RFSGGRSGTDFTLTISSLQPDDFATYYCQQSYTNPE---VTFGGGTTVDIK 108
41 -61.800sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  24  1..QSVLTQPPSVSAAPGQEVTISCSGSSSGDNFVSWYQQLPGTAPKLLIYDNNKRPSGIPD-------RFSGSKSGTSATLGITGLQTGDEADYYCGTWDS--SLSVGMFGGGTRVTVL 110
42 -61.700sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  25  3...XMTQSPSSLSASVGDRVTITCRAGQSVNKYLNWYQQKPGKAPKVLIFAASSLKSGVPS-------RFSGSGSGTDFTLTISGLLPEDFATYYCQQSYT----TPYTFGPGTKVEMT 107
43 -61.600sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  25  1..QSVLTQPPSVSAAPGQKVTISCSGSSSGNDYVSWYQQVPGTAPKLLIYDNNKRPSGIPD-------RFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSLS--GWVFGGGTKLTVL 110
44 -61.600sp|P01767|HV306_HUMAN Ig heavy chain V-III region BUT OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..EVQLVETGGGLIQPGGSLRLSCAASGFSXHSMSWVRQAPGKALXWVSAIYRGGTT-YYADSVKGRFTISRDDSRXTVYLQMXSLRAEDTAVYYCARDLAAAR----LFGKGTTVTVS 114
45 -61.500sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  26  2....VLSQPPSVSVAPGQTARITCGGDGIGGKSVHWYQQKPGQAPVLVVHEDNDRPAGIPE-------RFSGSNSGNTAALTISRVEAGDEADYYCEVWDD--RTAHVVFGGGTKLTVL 107
46 -61.500sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  24  2....ALTQPPSVSVSPGQTAVITCSGDNLEKTFVSWFQQRPGQSPLLVIYHTSERPSEIPE-------RFSGSSSGATATLTISGAQSVDEADYFCQTWDT----ITAIFGGGTKLTVL 105
47 -61.400sp|P06319|LV605_HUMAN(removed signalp:1-19) Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1  ali follow..  24  1..NFMLTQPHSVSESPGKTVTISCTGNSGASNYVQWYQQRRVSAPTIVIYEDNQ-----RPLGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSFDNTNQG---VFGGGTKLTVL 111
48 -61.400sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  29  1..QSVLTQPPSVSAAPGQKVTISCSGGSTGNNYVSWHQHLPGTAPKLLIYEDNKRPSGIPD-------RISASKSGTSATLGITGLRTGDEADYYCATWDSSLN--AVVFGGGTKVTVL 110
49 -61.300sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  23  1..QSVLTQPPSASGTPGQRVTISCSGGNFGRNSVNWYQVHPGTAPRLLIYSSDQRSSGVPD-------RFSGSKSGTSASLAISGLQSENEADYFCATWDDSLD--GPVFGGGTKVTVL 110
50 -61.200sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  26  3...QLTQSPSSLSASVGDRVTITCRASQSVYNYVAWFQQKPGKAPKSLIYDASTLQSGVPS-------NFTGSGSGTDFILTISSLQPEDFATYYCQQYNS----YPYTFGQGTKVQIK 107
51 -61.200sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  22  3...QMTQSPSTLSASVGDRVAITCRASQNISSWLAWYQQKPGKAPKVLIYKSSSLESGVPS-------RFSGSGSGTDFTLTISSLXPXXFATYYCQQYNTF-----FTFGPGTKVDIK 106
52 -61.200sp|P01721|LV601_HUMAN Ig lambda chain V-VI region AR OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..DFMLTQPHSVSESPGKTVTFSCTGSGGADSFVQWYQQRPGSAPTTVIYDDNQ-----RPSGVPDRFSGSIDDSANSASLTISGLKTEDEADYYCQSYNS---NHHVVFGGGTKVTVL 111
53 -61.100sp|P06318|LV604_HUMAN Ig lambda chain V-VI region WLT OS=Homo sapiens PE=1 SV=1  ali follow..  20  1..NFMLTQPLSVSGSPEKTVTISCTGSSGGSNYVQWYQQRPGSAPTNVIYENNQRPS-----EVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDNNNH----VVFGGTRLTVL 110
54 -61.100sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  26  3...QMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQKPGKAPKLLIYAASSLQSGVTS-------RFSGSGSGTDFTLTISSLQPEDSATYYCQQSYS----TLITFGQGTRLEI. 106
55 -61.000sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  27  1..QSVLTQPPSVSGTPGQRVTISCSGGSTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPD-------RFSGSKSGTSASLAISGLRSEDEAHYHCAAWDY--RLSAVVFGGGTQLTVL 111
56 -60.900sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  24  3...QMTQSPSSLSASVGDRVTITCQASQDIIKYLNWYQQTPGKAPKLLIYEASNLQAGVPS-------RFSGSGSGTDYTFTISSLQPEDIATYYCQQYQS----LPYTFGQGTKLQIT 107
57 -60.800sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1  ali follow..  19  1..EVQLLESGGGLVQPGGSLRLSCAASGFSTYVMSWVRQAPGKGLXWVGAIXGLSVSXSYAXSVKGRFTISRDDS----KNTMNSLRAEDTAVYYCAKGKV-SAYYFXYWGXGTLVTVS 114
58 -60.800sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  26  1..DFMLTQPHSVSESPGKTVIISCTRSDGAGYYVQWYQQRPGRAPTTVIFEDTQ-----RPSGVPDRFSGSIDRSSNSASLTISGLQTEDEADYYCQSYDRD----HWVFGGGTKLTVL 110
59 -60.700sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  24  3...QMTQSPSSLSASVGDRVTITCRAGHNITNFLSWYQQKPGKAPTLLIYAVSNLQVGVPS-------RFSGSGSGAEFTLTISSLQPEDFATYYCQQNYN----FSFTFGGGTKVDN. 106
60 -60.700sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  23  1..QSALTQPASVSGSPGQSITISCTGTTSSYNFVSWYQQNPGKAPKLMIYEGNKRPSGVSN-------RFSGSKSGKTASLTISGLQVEDEADYYCCSYAGNS---TRVFGGGTRVTVL 110
61 -60.600sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  24  1..QSVLTQPPSASGTPGGRVTISCSGSSGSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVPD-------RFSASRSGTSASLAISGLQSEDEADYYCAAWDDSLDG--YVFGTGTKVTV. 110
62 -60.500sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  23  3...QMTQSPSSLSASVGDRVTITCQASQDISDYLNWYQQKPGKAPKLLIYDASNLESGVPS-------RFSGGGSGAHFTFTISSLQPEDIATYYCQQYDY----LPWTFGQGTKVEIK 107
63 -60.500sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  23  3...QMTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPKILIYDASNLETGVPS-------RFSGSGFGTDFTFTISGLQPEDIATYYCQQYDT----LPRTFGQGTKLEIK 107
64 -60.500sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  25  2....DLTQPPSVSVSPGQTASITCSGDKLGDKDVCWYQQRPGQSPVLVIYQDNQRSSGIPE-------RFSGSNSGNTATLTISGTQAMDEADYYCQAWDS----MSVVFGGGTRLTVL 105
65 -60.300sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  25  3...QMTQSPSSLSASVGDRVTITCRASQSISSYLSWYQQKPGKAPQVLIYAASSLPSGVPS-------RFSGSGSGTDFTLTISSLQPEDFATYYCQQNYI----TPTSFGQGTRVEIK 107
66 -60.300sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..QSALTQPPSASGSPGQSVTISCTGTSSDNKYVSWYQQHPGRAPKLVIFEVSQRPSGVPD-------RFSGSKSDNTASLTVSGLRAEDEADYYCSSYVDNN---NFVFGGGTKLTV. 109
67 -60.300sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  24  3...QMTQSPSSLSASVGDRVTITCRASQGIRNDLTWYQQKPGTAPKRLIYGATSLQSGVPS-------RFSGSGSGTEFTLTINSLQPEDFATYYCLQYSS----FPWTFGQGTKVEVK 107
68 -60.200sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  27  1..QSVLTQPPSASGTPGQRVTISCFGSSSGRYYVYWYQQLPGTTPKLLIYKDNQRPSGVPD-------RFSGSKSGTSASLAISGLRSEDEADYYCAAWDD----SLWVFGGGTTLTVL 108
69 -60.200sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  24  1..QSVLTQPPSLSAAPGQRVSISCSGSSSGKNYVDWYQQLPGTAPKLLIFNNNKRPSGIPD-------RFSGSKSGTSATLGITGLQTGDEAIYYCGTWDN----RRSVFGGGTNVTVV 108
70 -60.100sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  24  1..QSALTQPASVSASPGQSITISCTGTTNSYSYVSWYQQYPGKAPKVLIFDVNSRPSGVSH-------RFSGSKSGNTASLTISGLQAEDEAHYFCSSYRTSG---TIIFGGGTYVTV. 109
71 -60.100sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  23  3...QMTQSPSSLSASVGDRVTITCQASQDISIFLNWYQQKPGKAPKLLIYDASKLEAGVPS-------RFSGTGSGTDFTFTISSLQPEDIATYYCQQFDN----LPLTFGGGTKVDFK 107
72 -60.100sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  23  3...QMTQSPSTQPASVGDRVTITCRASQSINIWLAWYQQKPEKAPKLLIYKASTLETGVPS-------RFSGSGSGTEFTLTINSLQPDDFATYYCQQYSR----YPYTFGQGTKLDIK 107
73 -60.000sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  24  1..QSALTQPRSVSGSPGQSVTISCTGTSSAYNSVSWYQQHPGKAPKLMIFDVTKRPSGVPD-------RLSGSKSGDTASLTISGLRADDEADYYCCSYAG---RYSVIFGGGTKLTVL 110
74 -60.000sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  22  3...QMTQSPSSLSVSVGDRVTITCQASQNVNAYLNWYQQKPGLAPKLLIYGASTREAGVPS-------RFSGSGSGTDFTFTISSLQPEDIATYYCQQYNN----WPPTFGQGTKVEVK 107
75 -60.000sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  24  1..QSALTQPRSVSGSPGQSVTISCAGTSGGNHFVSWYQQHPGKAPKLIIYGVNKRPSGVPY-------RFSGSKSGNTASLTISGLQAEDEAHYYCCSYAGRF---TWVFGGGTNLTVL 110

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.