current user: public

If you have questions about the server, please let us know.

Query: sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst QSVLTQPPSASGTPGQRVTISCFGSSSNIGRYYVYWYQQLPGTTPKLLIYKDNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLWVFGGGTTLTVLSLast
1 -79.000sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali  100  1QSVLTQPPSASGTPGQRVTISCFGSSSNIGRYYVYWYQQLPGTTPKLLIYKDNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLWVFGGGTTLTVLS 109
2 -76.300sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  71  1QSVLTQPPSLSAAPGQRVSISCSGSSSNIGKNYVDWYQQLPGTAPKLLIFNNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNRRSVFGGGTNVTVVG 109
3 -75.000sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  73  1QSVLTQPPSVSAAPGQEVTISCSGSSSNIGDNFVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSVGMFGGGTRVTVLG 111
4 -74.700sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  77  1QSVLTQPPSASGTPGQRVTISCSGGNFDIGRNSVNWYQVHPGTAPRLLIYSSDQRSSGVPDRFSGSKSGTSASLAISGLQSENEADYFCATWDDSGPVFGGGTKVTVLG 111
5 -74.300sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  75  1QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQVPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSGWVFGGGTKLTVLG 111
6 -74.200sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  63  1QSALTQPRSVSGSPGQSLTISCSGAPCDVGCESVSWYQQHPGKAPKLIIYGFSNRPSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADSSVIFGAGTKLTVLR 110
7 -74.200sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  72  1QSVLTQPPSVSAAPGQKVTISCSGGSTNIGNNYVSWHQHLPGTAPKLLIYEDNKRPSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSAVVFGGGTKVTVLG 111
8 -73.100sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  63  1QSALTQPASVSGSPGQSITISCTGTTSDVSYNFVSWYQQNPGKAPKLMIYEGNKRPSGVSNRFSGSKSGKTASLTISGLQVEDEADYYCCSYAGNTRVFGGGTRVTVLS 111
9 -73.000sp|P06318|LV604_HUMAN Ig lambda chain V-VI region WLT OS=Homo sapiens PE=1 SV=1  ali follow..  62  1NFMLTQPLSVSGSPEKTVTISCTGSSGSIGSNYVQWYQQRPGSAPTNVIYENNQRPSEVPDRFSGSISSNSASLTISGLKTEDEADYYCQSYDNNNHVVFGGTRLTVLG 111
10 -72.700sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  68  1QSALTQPPSASGSPGQSVTISCTGTSSDVDNKYVSWYQQHPGRAPKLVIFEVSQRPSGVPDRFSGSKSDNTASLTVSGLRAEDEADYYCSSYVDNNFVFGGGTKLTVLR 111
11 -72.600sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  62  1DFMLTQPHSVSESPGKTVIISCTRSDGTIAGYYVQWYQQRPGRAPTTVIFEDTQRPSGVPDRFSGSISSNSASLTISGLQTEDEADYYCQSYDRDHWVFGGGTKLTVL. 110
12 -72.500sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  59  1QSALTQPASVSASPGQSITISCTGTTNDISYSYVSWYQQYPGKAPKVLIFDVNSRPSGVSHRFSGSKSGNTASLTISGLQAEDEAHYFCSSYRTSTIIFGGGTYVTVLR 111
13 -72.200sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  66  1QSALTQPRSVSGSPGQSVTISCAGTSDVGGNHFVSWYQQHPGKAPKLIIYGVNKRPSGVPYRFSGSKSGNTASLTISGLQAEDEAHYYCCSYAGRTWVFGGGTNLTVLG 111
14 -72.000sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  81  1QSVLTQPPSASGTPGGRVTISCSGSSSNVSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSGYVFGTGTKVTVLR 112
15 -72.000sp|P01722|LV602_HUMAN Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1  ali follow..  57  1NLMLIQPPSVSESPGKTVTMSCTRTSDSIASNYVQWYRQRPGGAPTTLIYDTNQRPYGVPNRFSGSFSSNSASLTISGLTNDDTAMYFCQSYDSSNLVFGGGTKLTVLS 112
16 -72.000sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  81  1QSVLTQPPSVSGTPGQRVTISCSGGSNGTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRAVVFGGGTQLTVLR 112
17 -71.700sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  55  2..ALTQPPSVSVSPGQTAVITCSGDNL--EKTFVSWFQQRPGQSPLLVIYHTSERPSEIPERFSGSSSGATATLTISGAQSVDEADYFCQTWDTITAIFGGGTKLTVLS 106
18 -71.700sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  63  1QSALTQPRSVSGSPGQSVTISCTGTSSDVAYNSVSWYQQHPGKAPKLMIFDVTKRPSGVPDRLSGSKSGDTASLTISGLRADDEADYYCCSYAGRSVIFGGGTKLTVLG 111
19 -71.400sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  64  1QSALTQPPRVSGSPGQSVTISCTGSYSNVGYNHVSWYQQDPGKVPKLMIYDVDKRPSGVPDRFSGSKSANTASLTISGLQANNEADYYCSSYGGTSLIFGGGTKLTVLG 111
20 -71.200sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  66  1QSALTQPPSASGSLGQSVTISCTGTSSDVGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSNFVFGTGTKVTVLG 111
21 -71.200sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  63  1HSALTQPASVSGSLGQSITISCTGTSSDVGYNYVSWFQQHPGTAPKLIISEVRNRPSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYTSSSVVFGGGTKLTVL. 110
22 -70.900sp|P01721|LV601_HUMAN Ig lambda chain V-VI region AR OS=Homo sapiens PE=1 SV=1  ali follow..  60  1DFMLTQPHSVSESPGKTVTFSCTGSGGSIADSFVQWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSISANSASLTISGLKTEDEADYYCQSYNSNHVVFGGGTKVTVLG 112
23 -70.900sp|P01708|LV205_HUMAN Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  65  1QSALTQPRSVSGSPGHSVTISCIGTSSNVDYKYVSWYQQHPGKAPKLIIYEVSSRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYIGS-YVFGTGTKVIVL. 108
24 -70.500sp|P06319|LV605_HUMAN(removed signalp:1-19) Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1  ali follow..  61  1NFMLTQPHSVSESPGKTVTISCTGNSGSIASNYVQWYQQRRVSAPTIVIYEDNQRPLGVPDRFSGSISSNSASLTISGLKTEDEADYYCQSFDNTQGVFGGGTKLTVLG 112
25 -70.300sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  63  1QSALTQPASVSGSPGQSITISCTGTTSDVGYDFVSWYQQHPGKAPKLLIYDVNSRPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTTRAVFGGGTKLSVLG 112
26 -69.900sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  61  2..DLTQPPSVSVSPGQTASITCSGDKL--GDKDVCWYQQRPGQSPVLVIYQDNQRSSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSMSVVFGGGTRLTVLS 106
27 -69.700sp|P01781|HV320_HUMAN Ig heavy chain V-III region GAL OS=Homo sapiens PE=1 SV=1  ali follow..  27  1EVQLVESGGDLVQPGRSLRLSCAASGFXFXXLGMTWVRQAPGKGLEWVANIKXXYVDSVKGRFTISRAKNSLYLQMNSLRVEDTALYYCARGWGGGDYWGQGTLVTVST 116
28 -69.700sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  46  1XIVLTXSPTLSLSPGXRAALSCRASQ-SLSGNYLAWYQQKPGQAPRLLMYGVSSRATGIPDRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSSPFTFGQGSKLEIK. 108
29 -69.600sp|P01767|HV306_HUMAN Ig heavy chain V-III region BUT OS=Homo sapiens PE=1 SV=1  ali follow..  30  1EVQLVETGGGLIQPGGSLRLSCAASGFTVSXHSMSWVRQAPGKALXWVSAITTYYADSVKGRFTISRSRXTVYLQMXSLRAEDTAVYYCARDLAAARLFGKGTTVTVSS 115
30 -69.400sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  59  1ASALTQPRSLSGSPGQAVTISCTGLSVVDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGNYIVFGQGTDLTVLG 111
31 -69.400sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  51  3FYELTQPPSVSLAAGQTAMITCEGNDI--GERSVHWYQQKPGQAPVPVIYDDADRPSGVPARFSGYNSGNSAILTINRVEAGDEADYFCQSWDNGEVVFGTGTMVTVLG 111
32 -69.200sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  45  1EIVMTQSPTLSVSPGERATLSCRASQ-SISNSYLAWYQQKPSGSPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPTFGQGTRVEIKR 109
33 -69.100sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  47  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTSPRTFGQGTKVEIKR 109
34 -69.000sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  57  1.SELTQDPAVSVALGQTVRITCQGDSL--RGYDAAWYQQKPGQAPLLVIYGRNNRPSGIPDRFSGSSSGHTASLTITGAQAEDEADYYCNSRDSSHVLFGGGTKLTVL. 107
35 -68.700sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  46  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSNSFLAWYQQKPGQAPRLLIYVASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVELKR 109
36 -68.500sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  45  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSNSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSSPQTFGQGSKVEIKR 109
37 -68.500sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIVLTQSPSLPVTPGEPASISCRSSQNLLXGXYLDWYLXKPGXSPXLLIYLGSNRASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQTPLTFGGGTNVEIKR 112
38 -68.400sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  42  1DIQMTQSPSLSATVGDRVTLLCEASQSESGNTFLAWYQQKPKKAPKLLIYDASNLETGVPSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLPSTFGVASKVESKR 112
39 -68.300sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  59  1SYELTQPPSVSVSPGQTARITCSANAL--PNQYAYWYQQKPGRAPVMVIYKDTQRPSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNSASIFGGGTKLTVL. 106
40 -68.100sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  49  1DIVMTQSPSLAVSLGERATINCKSSQSVLSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYSFGQGTKLEIKR 114
41 -68.100sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  46  1EIVLTQSPTLSLSPGERATLSCRAALLS-SRGYLAWYQQKPGQAPRLLMYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPRSFGQGTKVEIKR 109
42 -68.000sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQLTQSPSLSASVGDRVTITCRASQS--VYNYVAWFQQKPGKAPKSLIYDASTLQSGVPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSYPYTFGQGTKVQIKR 108
43 -68.000sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  48  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSSPWTFGQGTKVEIKR 109
44 -67.900sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIVMTQSPSLPVTPGEPASISCRSSQHSDGFDYLNWYLQKPGQSPXLLIYALSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQAPITFGQGTRLEIKR 113
45 -67.800sp|P06331|HV209_HUMAN(removed signalp:1-20) Ig heavy chain V-II region ARH-77 OS=Homo sapiens PE=4 SV=1  ali follow..  28  1QVQLQQWGAGLVKPSETLSLTCAVFGGSFSGYYWSWIRQPPGRGLEWIGEISTNYKTSLKSRVTISLSKNLFSLKLSSVTAADTAVYYCARGLLRMDVWGQGTTVTVSS 126
46 -67.800sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  47  1DIQMTQSPSLSASVGDRVTITCRASQS--ISSYLSWYQQKPGKAPQVLIYAASSLPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYITPTSFGQGTRVEIKR 108
47 -67.700sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  46  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSSGYLGWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSLGRTFGQGTKVEIKR 109
48 -67.700sp|P83593|KV405_HUMAN Ig kappa chain V-IV region STH (Fragment) OS=Homo sapiens PE=1 SV=1  ali follow..  48  1DIVMTQSPSLVVSLGERATINCRSSQSSNNKNYLAWYQQKPGQAPKLLFSWASTRESGVPDRFSGSGSGTDFTLTIPGLQAEDVAVYYCQQYYRIPYTFGQGAK..... 109
49 -67.700sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  47  1XIXMTQSPSLSASVGDRVTITCRAGQS--VNKYLNWYQQKPGKAPKVLIFAASSLKSGVPSRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTTPYTFGPGTKVEMTR 108
50 -67.700sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  49  1DIQMTQSPSLSASVGDRVTITCRASQS--ISNYLNWYQQKPGKAPKLLIYAASSLQSGVTSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYSTLITFGQGTRLEIK. 107
51 -67.700sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  43  1DIQMTQSPSLSASVGDRVTITCRAGHN--ITNFLSWYQQKPGKAPTLLIYAVSNLQVGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNFSFTFGGGTKVDNK. 107
52 -67.600sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  49  1DIVMTQSPSLAVSLGERATINCKSSQSILNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNLPWTFGQGTKVEIKR 114
53 -67.500sp|P80419|HV322_HUMAN Ig heavy chain V-III region GAR OS=Homo sapiens PE=1 SV=1  ali follow..  26  1EVQLVESGGGLVQPGESLKLSCTASGFSYSNYVMTWVRQAPGKGLEWVTNIRPDYSDSVRFTVSRDNARNSVSNSMFLQRVEDTATYYCARVSDFPDFWGQGTLVSVTS 118
54 -67.400sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  44  5DIVMTQSPSLPVTPGEPASISCRSSQSLLHSNYLDWYLQKPQQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQTPQTFGQGTKVEIKR 117
55 -67.400sp|P01772|HV311_HUMAN Ig heavy chain V-III region KOL OS=Homo sapiens PE=1 SV=1  ali follow..  30  1QVQLVESGGGVVQPGRSLRLSCSSSGFIFSSYAMYWVRQAPGKGLEWVAIIDQHYADSVKGRFTISRSKNTLFLQMDSLRPEDTGVYFCARDGGHPDYWGQGTPVTVSS 126
56 -67.400sp|P06326|HV107_HUMAN Ig heavy chain V-I region Mot OS=Homo sapiens PE=1 SV=1  ali follow..  29  1QVQLVQSGAEVKKPGSSARLSCKVSGDDFNTYDIHWVRQAPGRGLEWMAVVRTTYGPRSQARFTVTRSTTTVYMELTALISADTAIYYCARGAHYLGPWGQGTLLIVSS 125
57 -67.400sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  47  1DVVMTQSPSLPVTLGQPASISCRSSQSSDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWSWTFGQGTKVEIKR 113
58 -67.300sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQMTQSPSLSASVGDRVTITCQASQD--IIKYLNWYQQTPGKAPKLLIYEASNLQAGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSLPYTFGQGTKLQITR 108
59 -67.300sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  45  1DIQMTQSPSLSASVGDRVTITCQASQD--INHYLNWYQQGPKKAPKILIYDASNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKLEIKR 108
60 -67.200sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  46  2DIVMTQTPSLPVTPGEPASISCRSSQSLLGNTYLNWYLQKAGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEIPYTFGQGTKLEIRR 115
61 -67.200sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  43  1DIQMTQSPPLSASVGDSVTITCQASQD--IRNSLIWYQQKPGKAPKFLIYDAENLEIGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNLPYTFGQGTKLEIKR 108
62 -67.200sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQMTQSPSLSASVGDRVTITCQASQD--ISDYLNWYQQKPGKAPKLLIYDASNLESGVPSRFSGGGSGAHFTFTISSLQPEDIATYYCQQYDYLPWTFGQGTKVEIKR 108
63 -67.200sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  50  1DIQMTXSPSLSASVGXRVTITCRASXT--ISSYLXWYXXKPGKAPXLLIYAASXLHSGVPSRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSSPTTFGXGTRLXIKR 108
64 -67.100sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  45  1DIQMTQSPSLSASVGDRVTITCQASQD--ISIFLNWYQQKPGKAPKLLIYDASKLEAGVPSRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNLPLTFGGGTKVDFKR 108
65 -67.100sp|P01771|HV310_HUMAN Ig heavy chain V-III region HIL OS=Homo sapiens PE=1 SV=1  ali follow..  30  1QVKLVQAGGGVVQPGRSLRLSCIASGFTFSNYGMHWVRQAPGKGLEWVAVIRTYYGDSVKGRFTISRSKRTLYMXMNSLRTEDTAVYYCARDPDIFDYWGQGVLVTVSS 121
66 -67.100sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  46  1EIVLTQSPTLSLSPGESATLSCRASQS--VSSNLAWYQQKRGQSPRLLIRDASSRANGIPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYSTSPYTFGQGTKLEIKR 108
67 -67.000sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  44  1DVVMTQSPFLPVTLGEPASIQCRSSQSLVGXTYLXWYLQKPGQSPELLIYLSSYRDSGVPDRFSDSGSGTDFTLKITRVQAEDVGVYYCMQATXSPYTFGQGTKLXIKR 113
68 -67.000sp|P01770|HV309_HUMAN Ig heavy chain V-III region NIE OS=Homo sapiens PE=1 SV=1  ali follow..  33  1QVQLVQSGGGVVQPGRSLRLSCAASGFTFSRYTIHWVRQAPGKGLEWVAVMSYXYADSVNGRFTISRSKNTLYLNMNSLRPEDTAVYYCARIRDTFAHWGQGTLVTVSS 119
69 -67.000sp|P01715|LV401_HUMAN Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1  ali follow..  60  2..GLTQPPSLSVSPGQTASITCSGDKL--GEQYVCWYQQKPGQSPVLVIYHDSKRPSGIPERFSGSNSGTTATLTISGTQAMDEADYYCQAWDSYTVIFGGGTKLTVLG 106
70 -67.000sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  43  1DIQMTQSPTQPASVGDRVTITCRASQS--INIWLAWYQQKPEKAPKLLIYKASTLETGVPSRFSGSGSGTEFTLTINSLQPDDFATYYCQQYSRYPYTFGQGTKLDIKR 108
71 -67.000sp|P01768|HV307_HUMAN Ig heavy chain V-III region CAM OS=Homo sapiens PE=1 SV=1  ali follow..  29  1QVELVESGGGVVXPGRSLRLSCAASGFTFSNYAMHWVRQPPGKGLEWVAVISYXYAXSVKGRFTISRSKXTLYLQMNSLRAEXTAVYYCARDRPLFNYWGQGTLVTVSS 122
72 -67.000sp|P01782|HV321_HUMAN Ig heavy chain V-III region DOB OS=Homo sapiens PE=1 SV=1  ali follow..  30  1EVQLVESGGDLVQPGRSLRLSCAASGFNFHEYNMHWLRQGPGKGPEWVSTITWNYADSVKGRFAISRAQKTLYLQLNILRPEDTAFYYCAKGYIWFDSWGQGTLVTVSS 120
73 -66.900sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  47  1DIQMTQSPSLSVSVGDRVTITCQASQN--VNAYLNWYQQKPGLAPKLLIYGASTREAGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYNNWPPTFGQGTKVEVKR 108
74 -66.800sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  50  1DIVMTQSPSLAVSLGERATINCKSSQSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP-TFGGGTKVEIKR 113
75 -66.800sp|P01769|HV308_HUMAN Ig heavy chain V-III region GA OS=Homo sapiens PE=1 SV=1  ali follow..  29  1QVXLVXSGGGAVXPGRSLRLSCAASGFSFSTYAMHWVRQAPGKGLXWLSVISYXYAASVKGRFTISRSKXTMYLEMNSLRAENTAVYYCARSGIATDYWGXGTLVTISS 122

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.