current user: public

If you have questions about the server, please let us know.

Query: sp|P04435|TVB2_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region CTL-L17 OS=Homo sapiens GN=TCRB PE=2 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst GVSQNPRHNITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLAGLNQPQHFGDGTRLSILLast
1 -78.500sp|P04435|TVB2_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region CTL-L17 OS=Homo sapiens GN=TCRB PE=2 SV=1  ali  100  1GVSQNPRHNITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLAGLNQPQHFGDGTRLSIL 112
2 -72.700sp|P01733|TVB1_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region YT35 OS=Homo sapiens GN=TRBV12-3 PE=1 SV=1  ali follow..  53  1GVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSFSTANYGYTFGSGTRLTVV 114
3 -60.000sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  28  4.MTQSPSSLSASVGDRVIITCRASQSVDYLNWYQQKPGKAPKLLIFDTS----NLQSGVPSRFSGGR-SGTDFTLTISSLQPDDFATYYCQQSYTNP--EVTFGGGTTVDI. 107
4 -59.800sp|P04437|TVA2_HUMAN(removed signalp:1-21) T-cell receptor alpha chain V region CTL-L17 OS=Homo sapiens GN=TCRA PE=2 SV=1  ali follow..  28  9.VKQNSPSLSVQEGRISILNCDYTNSFDYFLWYKKYPAEGPTFLISISSIK----DKNEDGRFTVFLNSAKHLSLHIVPSQPGDSAVYFCAAKGAGTASKLTFGTGTRLQV. 116
5 -59.300sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  32  4.MTQSPATLSVSPGERATLSCRASQSSNNLAWYQQKPGQPPRLLIYGAS----TRATGIPARFSGSG-SGTEFTLTISRLQSEDFAVYYCQQYNNWP--PWTFGQGTRVEI. 107
6 -59.100sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  33  4.MTQSPSSLSASVGDRVTITCRASQSSNYLNWYQQKPGKAPKLLIYAASS----LQSGVTSRFSGSG-SGTDFTLTISSLQPEDSATYYCQQSYST---LITFGQGTRLEI. 106
7 -59.000sp|P01737|TVA3_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region PY14 OS=Homo sapiens PE=1 SV=1  ali follow..  30  3.VTQLGSHVSVSEGALVLLRCNYSSSPPYLFWYVQYPNQGLQLLLKYTSAAT---LVKGINGFEAEFKSETSFHLTKPSAHMSDAAEYFCAVSDLSSASKIIFGSGTRLSI. 114
8 -59.000sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  29  4.MTQSPSSLSASVGDRVTITCRAGHNTNFLSWYQQKPGKAPTLLIYAVS----NLQVGVPSRFSGSG-SGAEFTLTISSLQPEDFATYYCQQNYNF---SFTFGGGTKVDN. 106
9 -58.900sp|P03979|TVC_HUMAN(removed signalp:1-17) T-cell receptor gamma chain V region PT-gamma-1/2 OS=Homo sapiens GN=TRGV3 PE=2 SV=1  ali follow..  21  5.LEGRTKSVTRQTGSSAEITCDLTVNTFYIHWYLHQEGKAPQRLLYYDVSTARLESGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRKNYYKKLFGSGTTLVV. 118
10 -58.800sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.MTQSPSSLSASVGDRVTITCRAGQSNKYLNWYQQKPGKAPKVLIFAAS----SLKSGVPSRFSGSG-SGTDFTLTISGLLPEDFATYYCQQSYTT---PYTFGPGTKVEM. 106
11 -58.800sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  29  4.MTQSPDSLAVSLGERATINCKSSQNKNYLAWYQQKPGQPPKLLIYWAS----TRESGVPDRFSGSG-SGTDFTLTISSLQAEDVAVYYCQQYDTIP----TFGGGTKVEI. 111
12 -58.800sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  28  4.MTQSPSTLSASVGDRVAITCRASQNSSWLAWYQQKPGKAPKVLIYKSS----SLESGVPSRFSGSG-SGTDFTLTISSLXPXXFATYYCQQYNTF----FTFGPGTKVDI. 105
13 -58.600sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  31  4.LTXSPGTLSLSPGXRAALSCRASQSGNYLAWYQQKPGQAPRLLMYGVS----SRATGIPDRFSGSG-SGADFTLTISRLXPEDFAVYYCQQYGSS---PFTFGQGSKLEI. 107
14 -58.500sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  31  4.MTQSPSSLSASVGDRVTITCRASQSSSYLSWYQQKPGKAPQVLIYAAS----SLPSGVPSRFSGSG-SGTDFTLTISSLQPEDFATYYCQQNYIT---PTSFGQGTRVEI. 106
15 -58.500sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.MTQSPSSLSASVGDRVTITCQASQDIHYLNWYQQGPKKAPKILIYDAS----NLETGVPSRFSGSG-FGTDFTFTISGLQPEDIATYYCQQYDTL---PRTFGQGTKLEI. 106
16 -58.400sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  28  4.MTQSPVTLSVSPGERATLSCRASQSNSYLAWYQQKPSGSPRLLIYGAS----TRATGIPARFSGSG-SGTEFTLTISSLQSEDFAVYYCQQYNNW---PPTFGQGTRVEI. 107
17 -58.400sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  32  4.LTQSPGTLSLSPGERATLSCRASQSSSYLAWYQQKPGQAPRLLIYGAS----SRATGIPDRFSGSG-SGTDFTLTISRLEPEDFAVYYCQQYGTS---PRTFGQGTKVEI. 107
18 -58.300sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  26  4.LTQSPSSLSASVGDRVTITCRASQSYNYVAWFQQKPGKAPKSLIYDAS----TLQSGVPSNFTGSG-SGTDFILTISSLQPEDFATYYCQQYNSY---PYTFGQGTKVQI. 106
19 -58.300sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.MTQSPSSLSASVGDRVTITCQASQDSDYLNWYQQKPGKAPKLLIYDAS----NLESGVPSRFSGGG-SGAHFTFTISSLQPEDIATYYCQQYDYL---PWTFGQGTKVEI. 106
20 -58.300sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  31  4.MTQSPSPLSASVGDSVTITCQASQDINSLIWYQQKPGKAPKFLIYDAEN----LEIGVPSRFRGSG-SGTDFALSISSLQPEDFATYYCQQYYNL---PYTFGQGTKLEI. 106
21 -58.200sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  31  4.MTQSPSSLSASVGDRVTITCQASQDIKYLNWYQQTPGKAPKLLIYEAS----NLQAGVPSRFSGSG-SGTDYTFTISSLQPEDIATYYCQQYQSL---PYTFGQGTKLQI. 106
22 -58.200sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  31  4.MTQSPSSLSASVGDRVTIICRASQGRNDLTWYQQKPGKAPKELIYAAS----NLQSGVPSRFSGSG-AGTEFTLTISSLQPEDFATYYCLQQNSY---PRSFGQGTKVEI. 106
23 -58.100sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  28  4.MTQSPSSLSVSVGDRVTITCQASQNNAYLNWYQQKPGLAPKLLIYGAS----TREAGVPSRFSGSG-SGTDFTFTISSLQPEDIATYYCQQYNNW---PPTFGQGTKVEV. 106
24 -58.100sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  30  4.MTQSPSSLSASVGDRVTITCRASQGRNDLTWYQQKPGTAPKRLIYGAT----SLQSGVPSRFSGSG-SGTEFTLTINSLQPEDFATYYCLQYSSF---PWTFGQGTKVEV. 106
25 -58.000sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  31  4.MTQSPDSLAVSLGERATINCKSSQSKNYLAWYQQKPGQPPKLLIYWAS----TRESGVPDRFSGSG-SGTDFTLTISSLQAEDVAVYYCQQYYST---PYSFGQGTKLEI. 112
26 -58.000sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  31  4.LTQSPGTLSLSPGERATLSCRASQSNSFLAWYQQKPGQAPRLLIYVAS----SRATGIPDRFSGSG-SGTDFTLTISRLEPEDFAVYYCQQYGSS---PSTFGQGTKVEL. 107
27 -57.900sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.MTQSPSTLSVSVGDRVTITCEASQTLSYLNWYQQKPGKAPKLLIYAASS----LETGVPSRFSGQG-SGTXFTFTISSVXPXXFATYYCQXYLDL---PRTFGQGTKVDL. 106
28 -57.900sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  30  4.MTQSPSTQPASVGDRVTITCRASQSNIWLAWYQQKPEKAPKLLIYKAS----TLETGVPSRFSGSG-SGTEFTLTINSLQPDDFATYYCQQYSRY---PYTFGQGTKLDI. 106
29 -57.900sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  32  4.LTQSPGTLSLSPGERATLSCRAALSRGYLAWYQQKPGQAPRLLMYGAS----SRATGIPDRFSGSG-SGTDFTLTISRLEPEDFAVYYCQQYGSS---PRSFGQGTKVEI. 107
30 -57.900sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  28  4.MTQSPSSLSASVGDRVTITCQASQDSIFLNWYQQKPGKAPKLLIYDAS----KLEAGVPSRFSGTG-SGTDFTFTISSLQPEDIATYYCQQFDNL---PLTFGGGTKVDF. 106
31 -57.800sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  32  4.LTQSPGTLSLSPGERATLSCRASQSNSYLAWYQQKPGQAPRLLIYGAS----SRATGIPDRFSGSG-SGTDFTLTISRLEPDDFAVYYCQQYGSS---PQTFGQGSKVEI. 107
32 -57.800sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  23  4.MTQSPSSLSATVGDRVTLLCEASQGNTFLAWYQQKPKKAPKLLIYDAS----NLETGVPSRFSESG-SGTDFTFTISGLXPXXFAVYYCQXYDTLPS---TFGVASKVES. 110
33 -57.700sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  33  4.LTQSPGTLSLSPGERATLSCRASQSSSYLAWYQQKPGQAPRLLIYGAS----SRATGIPDRFSGSG-SGTDFTLTISRLEPXDFAVYYCQQYGSS---PWTFGQGTKVEI. 107
34 -57.500sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  33  4.LTQSPGTLSLSPGESATLSCRASQSSSNLAWYQQKRGQSPRLLIRDAS----SRANGIPDRFSGSG-SGTDFTLIISRLEPEDFAVYYCQQYSTS---PYTFGQGTKLEI. 106
35 -57.500sp|P01817|HV204_HUMAN Ig heavy chain V-II region MCE OS=Homo sapiens PE=1 SV=1  ali follow..  20  4.LKESGP-TLVKPTETLTLTCTFSGSGVGVGWIRQRPGKALEWLAFINWDDDNRYSPSLRSRLTGTKDSRNQVVLTITNMDPVDSGTYFCAHRPPWRGGFDXWGQGTLVTV. 123
36 -57.500sp|P06331|HV209_HUMAN(removed signalp:1-20) Ig heavy chain V-II region ARH-77 OS=Homo sapiens PE=4 SV=1  ali follow..  19  4.LQQWGA-GLVKPSETLSLTCAVFGSGYYWSWIRQPPGRGLEWIGEINHSGSTNYKTSLKSRVTISLDSKNLFSLKLSSVTAADTAVYYCARGLLRGGWNDVWGQGTTVTV. 124
37 -57.500sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  30  4.MTQSPSSVSASVGDRVTITCRASQDSHWLAWYQQKSGKAPKLLIYSAS----SLENGVPSRFSGSG-SGTEFTLTISSLQPEDFATYFCQQAHSV---PLTFGGGTTVDI. 106
38 -57.400sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  34  4.MTXSPSSLSASVGXRVTITCRASXTSSYLXWYXXKPGKAPXLLIYAASX----LHSGVPSRFSGSG-SGTXFTFTISSLXPXXFATYYCXXSYSS---PTTFGXGTRLXI. 106
39 -57.400sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  28  4.LTQSPLSLPVTPGEPASISCRSSQXGXYLDWYLXKPGXSPXLLIYLGS----NRASGVPNRFSGSG-SGTXFTLKISRVXAXXVGVYYCMQALQT---PLTFGGGTNVEI. 110
40 -57.300sp|P04436|TVA1_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region HPB-MLT (Fragment) OS=Homo sapiens PE=2 SV=1  ali follow..  27  3.VTQAQTEISVVEKEDVTLDCVYETTTYYLFWYKQPPSGELVFLIRRNSFD---EQNEISGRYSWNFQSTSSFNFTITASQVVDSAVYFCALDSSA--SKIIFGSGTRLSI. 110
41 -57.300sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  30  4.MTQSPDSLAVSLGERATINCKSSQNKNYLAWYQQKPGQPPKLLIYWAS----TRESGVPDRFSGSG-SGTDFTLTISSLQAEDVAVYYCQQYYNL---PWTFGQGTKVEI. 112
42 -57.200sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  33  3.VLTQPPSVSGTPGQRVTISCSGGSSNNYVYWYQQLPGTAPKLLIYRDD----KRPSGVPDRFSGSK-SGTSASLAISGLRSEDEAHYHCAAWDYRL-SAVVFGGGTQLTVL 111
43 -57.100sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.MTQSPSSLSASVGDRVTITCRASQDTNYVNWFQQRPGQAPKVLIYGAS----ILETGVPSRFSGSG-SGTDFTFTISSLQPEDIATYYCQQYDTL---PLTFGGGTKVDI. 106
44 -57.100sp|P01824|HV206_HUMAN Ig heavy chain V-II region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  18  4.LQESGP-GLVKPSETLSLTCIVSGTGYYWGWIRQPPGKGLEWIGGVYYTGSIYYNPSLRGRVTISVDSRNQFSLNLRSMSAADTAMYYCARGNPPPYYDIVWGQGTTVHV. 127
45 -57.100sp|P83593|KV405_HUMAN Ig kappa chain V-IV region STH (Fragment) OS=Homo sapiens PE=1 SV=1  ali follow..  28  4.MTQSPDSLVVSLGERATINCRSSQNKNYLAWYQQKPGQAPKLLFSWAS----TRESGVPDRFSGSG-SGTDFTLTIPGLQAEDVAVYYCQQYYRI---PYTFGQGAK.... 109
46 -57.000sp|P80421|HV108_HUMAN Ig heavy chain V-I region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  21  4.LVQSGV-ERKVPGASVRISCKASGENYYIHWVRQAPGLGLEWMGIFNPVAGAVSSEKFRDRLVMSSDSANTVSMQLRNLRSDDTGRYFCARVSYDFSQYDVWGQGTTVIV. 118
47 -57.000sp|P01814|HV201_HUMAN Ig heavy chain V-II region OU OS=Homo sapiens PE=1 SV=1  ali follow..  20  4.LTESGP-ALVKPKQPLTLTCTFSTSRMRVSWIRRPPGKALEWLARIXXXDKFYWSTSLRTRLSISKNSKNQVVLIMINVNPVDTATYYCARVVNSVMAGYVWGKGTTVTV. 124
48 -57.000sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  31  4.LTQSPGTLSLSPGERATLSCRASQSSGYLGWYQQKPGQAPRLLIYGAS----SRATGIPDRFSGSG-SGTDFTLTISRLEPEDFAVYYCQQYGSL---GRTFGQGTKVEI. 107
49 -56.900sp|P01825|HV207_HUMAN Ig heavy chain V-II region NEWM OS=Homo sapiens PE=1 SV=1  ali follow..  19  4.LEQSGP-GLVRPSQTLSLTCTVSGSNDYYTWVRQPPGRGLEWIGYVFYHGTSDDTTPLRSRVTMLVDSKNQFSLRLSSVTAADTAVYYCARNLIAG-CIDVWGQGSLVTV. 115
50 -56.900sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  33  3.VLTQPPSASGTPGGRVTISCSGSSSNXPAYWYQQLPGTAPKLLIYNYN----QRPSGVPDRFSASR-SGTSASLAISGLQSEDEADYYCAAWDDSL-DGYVFGTGTKVTVL 111
51 -56.800sp|P01770|HV309_HUMAN Ig heavy chain V-III region NIE OS=Homo sapiens PE=1 SV=1  ali follow..  20  4.LVQSGG-GVVQPGRSLRLSCAASGSRYTIHWVRQAPGKGLEWVAVMSYXXXKHYADSVNGRFTISRNSKNTLYLNMNSLRPEDTAVYYCARIRDTAMFFAHWGQGTLVTV. 117
52 -56.800sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  31  8.MTQSPLSLPVTPGEPASISCRSSQGYNYLDWYLQKPQQSPQLLIYLGS----NRASGVPDRFSGSG-SGTDFTLKISRVEAEDVGVYYCMQGLQT---PQTFGQGTKVEI. 115
53 -56.800sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  33  4.MTQSPLSLPVTPGEPASISCRSSQGFDYLNWYLQKPGQSPXLLIYALS----NRASGVPDRFSGSG-SGTDFTLKISRVEAEDVGVYYCMXALQA---PITFGQGTRLEI. 111
54 -56.700sp|P01816|HV203_HUMAN Ig heavy chain V-II region DAW OS=Homo sapiens PE=1 SV=1  ali follow..  20  4.LRESGP-ALVRPTQTLTLTCTFSGETMCVAWIRQPPGEALEWLAWDILNDDKYYGASLETRLAVSKDSKNQVVLSMNTVGPGDTATYYCARSCGSQ-YFDYWGQGILVTV. 117
55 -56.700sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  27  4.MTQSPSTLSASVGDRVTITCRASQSNTWLAWYQQKPGKAPKLLMYKAS----SLESGVPSRFIGSG-SGTEFTLTISSLQPDDFATYYCQQYNSD---SKMFGQGTKVEV. 106
56 -56.400sp|P01818|HV205_HUMAN Ig heavy chain V-II region HE OS=Homo sapiens PE=1 SV=1  ali follow..  20  4.LKENGP-TLVKPTETLTLTCTLSTDGVAVGWIRQGPGRALEWLAWLYWDDDKRFSPSLKSRLTVTRDSKNQVVLTMTNMDPVDTATYYCVHRHPRTLAFDVWGQGTKVAV. 119
57 -56.300sp|P01773|HV312_HUMAN Ig heavy chain V-III region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  18  4.LVESGG-GVVQAGTSLRLSCTASASDYAMHWVRQAPGKGLXWVALISYGGXTYYADSVRGRFTISRXSKXTLYLXMKTLRTEDTAVYYCAKLIAVAGTRXFWGQGTLVTV. 117
58 -56.200sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  30  5.MTQTPLSLPVTPGEPASISCRSSQGNTYLNWYLQKAGQSPQLLIYTLS----YRASGVPDRFSGSG-SGTDFTLKISRVQAEDVGVYYCMQRLEI---PYTFGQGTKLEI. 113
59 -56.200sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.LTQDP-AVSVALGQTVRITCQGDSRGYDAAWYQQKPGQAPLLVIYGRN----NRPSGIPDRFSGSS-SGHTASLTITGAQAEDEADYYCNSRDSSG-KHVLFGGGTKLTVL 107
60 -56.200sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  27  4.LTQPP-SASGSPGQSVTISCTGTSDNKYVSWYQQHPGRAPKLVIFEVS----QRPSGVPDRFSGSK-SDNTASLTVSGLRAEDEADYYCSSYVDN--NNFVFGGGTKLTVL 110
61 -56.100sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  28  4.LTQ-PASVSASPGQSITISCTGTTSYSYVSWYQQYPGKAPKVLIFDVN----SRPSGVSHRFSGSK-SGNTASLTISGLQAEDEAHYFCSSYRTS--GTIIFGGGTYVTVL 110
62 -56.100sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  32  4.MTQSPLFLPVTLGEPASIQCRSSQGXTYLXWYLQKPGQSPELLIYLSS----YRDSGVPDRFSDSG-SGTDFTLKITRVQAEDVGVYYCMQATXS---PYTFGQGTKLXI. 111
63 -56.100sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  29  4.MTQSPSSLSASVGDRVTITCQASQDRKHLNWYDQKPGKAPRLLIYGAS----TLETGVPSRFSGSG-SGTDFTLTISTLQPEDIGNYYCQQYDNV---PITFGQGTRVEN. 106
64 -56.000sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  28  4.MTQSPLSLPVTLGQPASISCRSSQGNTYLNWFQQRPGQSPRRLIYKVS----NRDSGVPDRFSGSG-SGTDFTLKISRVEAEDVGVYYCMQGTHW---SWTFGQGTKVEI. 111
65 -55.900sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  34  3.VLTQPPSVSAAPGQEVTISCSGSSGDNFVSWYQQLPGTAPKLLIYDNN----KRPSGIPDRFSGSK-SGTSATLGITGLQTGDEADYYCGTWDSSL-SVGMFGGGTRVTVL 110
66 -55.900sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  28  2SALTQPRSLSGSPGQAVTISCTGLPSDNFVSWYQQTPGRAPRLLIYDDS----LRPSGVPNRFSGSK-SDTKAALTISGLQPDDEATYFCCSYVGN--YIFVFGQGTDLTV. 109
67 -55.800sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  33  3.VLTQPPSVSAAPGQKVTISCSGSSGNDYVSWYQQVPGTAPKLLIYDNN----KRPSGIPDRFSGSK-SGTSATLGITGLQTGDEADYYCGTWNNSL-SGWVFGGGTKLTVL 110
68 -55.800sp|P01767|HV306_HUMAN Ig heavy chain V-III region BUT OS=Homo sapiens PE=1 SV=1  ali follow..  19  4.LVETGG-GLIQPGGSLRLSCAASGSXHSMSWVRQAPGKALXWVSAIYRGGTTYYADSVKGRFTISRDSRXTVYLQMXSLRAEDTAVYYCARDLAA---ARLFGKGTTVTV. 113
69 -55.800sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  31  3.VLTQPPSVSAAPGQKVTISCSGGSGNNYVSWHQHLPGTAPKLLIYEDN----KRPSGIPDRISASK-SGTSATLGITGLRTGDEADYYCATWDSSL-NAVVFGGGTKVTV. 109
70 -55.700sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  30  6.LTQPP-SVSLAAGQTAMITCEGNDGERSVHWYQQKPGQAPVPVIYDDA----DRPSGVPARFSGYN-SGNSAILTINRVEAGDEADYFCQSWDNGS-YEVVFGTGTMVTVL 110
71 -55.700sp|P01778|HV317_HUMAN Ig heavy chain V-III region ZAP OS=Homo sapiens PE=1 SV=1  ali follow..  20  4.LVESGG-ALVQPGGSGRLSCAASGSTTSRFWVRQAPGKGLEWVEFRVQGSISHYADSVQARFTISRNSKNTLYLQMNTGEAXXTAVYYCARTRPGGYFSDVWGQGTLVS.. 116
72 -55.700sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  28  3.ALTQPASVSGSPGQSITISCTGTTSYNFVSWYQQNPGKAPKLMIYEGN----KRPSGVSNRFSGSK-SGKTASLTISGLQVEDEADYYCCSYAGN--STRVFGGGTRVTV. 109
73 -55.600sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  27  4.LTQPP-RVSGSPGQSVTISCTGSYGYNHVSWYQQDPGKVPKLMIYDVD----KRPSGVPDRFSGSK-SANTASLTISGLQANNEADYYCSSYGGT--YSLIFGGGTKLTV. 109
74 -55.600sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1  ali follow..  18  4.LLESGG-GLVQPGGSLRLSCAASGSTYVMSWVRQAPGKGLXWVGAIGLSVSXSYAXSVKGRFTISRDD---SKNTMNSLRAEDTAVYYCAKGKVSAYYFXYWGXGTLVTV. 113
75 -55.500sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  28  3.ALTQPASVSGSPGQSITISCTGTTGYDFVSWYQQHPGKAPKLLIYDVN----SRPSGISNRFSGSK-SGNTASLTISGLQAEDEADYYCSSFTTTN-SRAVFGGGTKLSV. 110

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 4 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.