current user: public

If you have questions about the server, please let us know.

Query: sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst QSVLTQPPSLSAAPGQRVSISCSGSSSNIGKNYVDWYQQLPGTAPKLLIFNNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNRRSVFGGGTNVTVVGLast
1 -78.400sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali  100  1QSVLTQPPSLSAAPGQRVSISCSGSSSNIGKNYVDWYQQLPGTAPKLLIFNNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNRRSVFGGGTNVTVVG 109
2 -76.300sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  71  1QSVLTQPPSASGTPGQRVTISCFGSSSNIGRYYVYWYQQLPGTTPKLLIYKDNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLWVFGGGTTLTVLS 109
3 -75.900sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  78  1QSVLTQPPSVSAAPGQKVTISCSGGSTNIGNNYVSWHQHLPGTAPKLLIYEDNKRPSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSAVVFGGGTKVTVLG 111
4 -75.800sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  84  1QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQVPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSGWVFGGGTKLTVLG 111
5 -75.700sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  85  1QSVLTQPPSVSAAPGQEVTISCSGSSSNIGDNFVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSVGMFGGGTRVTVLG 111
6 -75.400sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  66  1QSVLTQPPSASGTPGQRVTISCSGGNFDIGRNSVNWYQVHPGTAPRLLIYSSDQRSSGVPDRFSGSKSGTSASLAISGLQSENEADYFCATWDDSGPVFGGGTKVTVLG 111
7 -74.000sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  56  1DFMLTQPHSVSESPGKTVIISCTRSDGTIAGYYVQWYQQRPGRAPTTVIFEDTQRPSGVPDRFSGSISSNSASLTISGLQTEDEADYYCQSYDRDHWVFGGGTKLTVLG 111
8 -73.900sp|P06318|LV604_HUMAN Ig lambda chain V-VI region WLT OS=Homo sapiens PE=1 SV=1  ali follow..  57  1NFMLTQPLSVSGSPEKTVTISCTGSSGSIGSNYVQWYQQRPGSAPTNVIYENNQRPSEVPDRFSGSISSNSASLTISGLKTEDEADYYCQSYDNNNHVVFGGTRLTVLG 111
9 -73.400sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  55  1QSALTQPRSVSGSPGQSLTISCSGAPCDVGCESVSWYQQHPGKAPKLIIYGFSNRPSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADSSVIFGAGTKLTVL. 109
10 -73.100sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  60  1QSALTQPRSVSGSPGQSVTISCTGTSSDVAYNSVSWYQQHPGKAPKLMIFDVTKRPSGVPDRLSGSKSGDTASLTISGLRADDEADYYCCSYAGRSVIFGGGTKLTVLG 111
11 -73.000sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  61  1QSALTQPPSASGSLGQSVTISCTGTSSDVGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSNFVFGTGTKVTVLG 111
12 -73.000sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  59  1QSALTQPPRVSGSPGQSVTISCTGSYSNVGYNHVSWYQQDPGKVPKLMIYDVDKRPSGVPDRFSGSKSANTASLTISGLQANNEADYYCSSYGGTSLIFGGGTKLTVLG 111
13 -72.900sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  57  1HSALTQPASVSGSLGQSITISCTGTSSDVGYNYVSWFQQHPGTAPKLIISEVRNRPSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYTSSSVVFGGGTKLTVLG 111
14 -72.700sp|P01708|LV205_HUMAN Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  59  1QSALTQPRSVSGSPGHSVTISCIGTSSNVDYKYVSWYQQHPGKAPKLIIYEVSSRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYIGS-YVFGTGTKVIVLG 109
15 -72.500sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  63  1QSALTQPRSVSGSPGQSVTISCAGTSSVGGNHFVSWYQQHPGKAPKLIIYGVNKRPSGVPYRFSGSKSGNTASLTISGLQAEDEAHYYCCSYAGRTWVFGGGTNLTVLG 111
16 -72.400sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  59  1QSALTQPASVSGSPGQSITISCTGTTSDVGYDFVSWYQQHPGKAPKLLIYDVNSRPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTTRAVFGGGTKLSVLG 112
17 -71.900sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  59  1QSALTQPPSASGSPGQSVTISCTGTSSDVDNKYVSWYQQHPGRAPKLVIFEVSQRPSGVPDRFSGSKSDNTASLTVSGLRAEDEADYYCSSYVDNNFVFGGGTKLTVL. 110
18 -71.700sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  58  1QSALTQPASVSASPGQSITISCTGTTNDISYSYVSWYQQYPGKAPKVLIFDVNSRPSGVSHRFSGSKSGNTASLTISGLQAEDEAHYFCSSYRTSTIIFGGGTYVTVL. 110
19 -71.600sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  69  1QSVLTQPPSASGTPGGRVTISCSGSSSNVSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSGYVFGTGTKVTVL. 111
20 -71.500sp|P01721|LV601_HUMAN Ig lambda chain V-VI region AR OS=Homo sapiens PE=1 SV=1  ali follow..  55  1DFMLTQPHSVSESPGKTVTFSCTGSGGSIADSFVQWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSISANSASLTISGLKTEDEADYYCQSYNSNHVVFGGGTKVTVLG 112
21 -71.500sp|P06319|LV605_HUMAN(removed signalp:1-19) Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1  ali follow..  55  1NFMLTQPHSVSESPGKTVTISCTGNSGSIASNYVQWYQQRRVSAPTIVIYEDNQRPLGVPDRFSGSISSNSASLTISGLKTEDEADYYCQSFDNTNQVFGGGTKLTVLG 112
22 -71.200sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  58  1QSALTQPASVSGSPGQSITISCTGTTSDVSYNFVSWYQQNPGKAPKLMIYEGNKRPSGVSNRFSGSKSGKTASLTISGLQVEDEADYYCCSYAGNTRVFGGGTRVTVLS 111
23 -71.200sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  72  1QSVLTQPPSVSGTPGQRVTISCSGGSSGTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRAVVFGGGTQLTVL. 111
24 -71.000sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  53  3FYELTQPPSVSLAAGQTAMITCEGND--IGERSVHWYQQKPGQAPVPVIYDDADRPSGVPARFSGYNSGNSAILTINRVEAGDEADYFCQSWDNGEVVFGTGTMVTVLG 111
25 -70.500sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  55  1SYELTQPPSVSVSPGQTARITCSANAL--PNQYAYWYQQKPGRAPVMVIYKDTQRPSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNSASIFGGGTKLTVLG 107
26 -70.500sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  56  1ASALTQPRSLSGSPGQAVTISCTGLPSVDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGNYIVFGQGTDLTVLG 111
27 -70.000sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  54  2..ALTQPPSVSVSPGQTAVITCSGDNL--EKTFVSWFQQRPGQSPLLVIYHTSERPSEIPERFSGSSSGATATLTISGAQSVDEADYFCQTWDTITAIFGGGTKLTVLS 106
28 -70.000sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  55  1.SELTQDPAVSVALGQTVRITCQGDS--LRGYDAAWYQQKPGQAPLLVIYGRNNRPSGIPDRFSGSSSGHTASLTITGAQAEDEADYYCNSRDSSHVLFGGGTKLTVLG 108
29 -69.900sp|P01722|LV602_HUMAN Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1  ali follow..  50  1NLMLIQPPSVSESPGKTVTMSCTRTSDSIASNYVQWYRQRPGGAPTTLIYDTNQRPYGVPNRFSGSFSSNSASLTISGLTNDDTAMYFCQSYDSSNLVFGGGTKLTVLS 112
30 -69.800sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  46  1XIVLTXSPTLSLSPGXRAALSCRASQ-SLSGNYLAWYQQKPGQAPRLLMYGVSSRATGIPDRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSSPFTFGQGSKLEIK. 108
31 -69.400sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  47  1EIVMTQSPTLSVSPGERATLSCRASQ-SISNSYLAWYQQKPSGSPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPTFGQGTRVEIK. 108
32 -69.200sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  48  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTSPRTFGQGTKVEIK. 108
33 -69.100sp|P01715|LV401_HUMAN Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1  ali follow..  61  2..GLTQPPSLSVSPGQTASITCSGDKL--GEQYVCWYQQKPGQSPVLVIYHDSKRPSGIPERFSGSNSGTTATLTISGTQAMDEADYYCQAWDSYTVIFGGGTKLTVLG 106
34 -68.900sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  48  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSNSFLAWYQQKPGQAPRLLIYVASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFGQGTKVELK. 108
35 -68.900sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  58  2..DLTQPPSVSVSPGQTASITCSGDKL--GDKDVCWYQQRPGQSPVLVIYQDNQRSSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSMSVVFGGGTRLTVLS 106
36 -68.600sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  43  1DIQMTQSPSLSATVGDRVTLLCEASQSESGNTFLAWYQQKPKKAPKLLIYDASNLETGVPSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLPSTFGVASKVESK. 111
37 -68.600sp|P06889|LV405_HUMAN Ig lambda chain V-IV region MOL OS=Homo sapiens PE=1 SV=1  ali follow..  58  2..ELTQPPSVSVSPGQTATISCSGDKL--GESYYDWYQQSPGQSPLLVIYEGDKRPSGIPXRFSGSNSGNTATLTISGTESMDEADYYCQAWNSSSVLFGGGTKLTVLG 106
38 -68.500sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  47  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSNSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSSPQTFGQGSKVEIK. 108
39 -68.300sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  48  1DIVLTQSPSLPVTPGEPASISCRSSQNLLXGXYLDWYLXKPGXSPXLLIYLGSNRASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQTPLTFGGGTNVEIK. 111
40 -68.200sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  56  2..VLSQPPSVSVAPGQTARITCGGDGI--GGKSVHWYQQKPGQAPVLVVHEDNDRPAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRHVVFGGGTKLTVLG 108
41 -68.100sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  46  1EIVLTQSPTLSLSPGERATLSCRAALLS-SRGYLAWYQQKPGQAPRLLMYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPRSFGQGTKVEIK. 108
42 -68.000sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  49  1DIVMTQSPSLAVSLGERATINCKSSQSVLSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYSFGQGTKLEIK. 113
43 -68.000sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  47  1DIQLTQSPSLSASVGDRVTITCRASQSV--YNYVAWFQQKPGKAPKSLIYDASTLQSGVPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSYPYTFGQGTKVQIK. 107
44 -68.000sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  46  1DIQMTQSPSLSASVGDRVTITCRAGHN--ITNFLSWYQQKPGKAPTLLIYAVSNLQVGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNFSFTFGGGTKVDNK. 107
45 -68.000sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  48  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSSPWTFGQGTKVEIK. 108
46 -67.700sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  48  1DIQMTQSPSLSASVGDRVTITCRASQS--ISNYLNWYQQKPGKAPKLLIYAASSLQSGVTSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYSTLITFGQGTRLEIK. 107
47 -67.700sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  48  1EIVLTQSPTLSLSPGERATLSCRASQ-SVSSGYLGWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSLGRTFGQGTKVEIK. 108
48 -67.600sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  44  1DIVMTQSPSLPVTPGEPASISCRSSQSLLHSDYLNWYLQKPGQSPXLLIYALSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQAPITFGQGTRLEIK. 112
49 -67.600sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  48  1DIQMTQSPSLSASVGDRVTITCRASQSI--SSYLSWYQQKPGKAPQVLIYAASSLPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYITPTSFGQGTRVEIK. 107
50 -67.500sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  50  1DIVMTQSPSLAVSLGERATINCKSSQSILNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNLPWTFGQGTKVEIK. 113
51 -67.500sp|P01767|HV306_HUMAN Ig heavy chain V-III region BUT OS=Homo sapiens PE=1 SV=1  ali follow..  26  1EVQLVETGGGLIQPGGSLRLSCAASGFTVSXHSMSWVRQAPGKALXWVSAIYRGYADSVKGRFTISRSRXTVYLQMXSLRAEDTAVYYCARDLAAARLFGKGTTVTVSS 115
52 -67.400sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  47  1DIQMTQSPTLSASVGDRVTITCRASQSI--NTWLAWYQQKPGKAPKLLMYKASSLESGVPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSDSKMFGQGTKVEVKG 108
53 -67.400sp|P01781|HV320_HUMAN Ig heavy chain V-III region GAL OS=Homo sapiens PE=1 SV=1  ali follow..  25  1EVQLVESGGDLVQPGRSLRLSCAASGFXFXXLGMTWVRQAPGKGLEWVANIKXXYVDSVKGRFTISRAKNSLYLQMNSLRVEDTALYYCARGWGGGDYWGQGTLVTVST 116
54 -67.300sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  46  5DIVMTQSPSLPVTPGEPASISCRSSQSLLHSNYLDWYLQKPQQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQTPQTFGQGTKVEIK. 116
55 -67.200sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  49  1XIXMTQSPSLSASVGDRVTITCRAGQS--VNKYLNWYQQKPGKAPKVLIFAASSLKSGVPSRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTTPYTFGPGTKVEMT. 107
56 -67.200sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQMTQSPSLSASVGDRVTITCQASQDI--SDYLNWYQQKPGKAPKLLIYDASNLESGVPSRFSGGGSGAHFTFTISSLQPEDIATYYCQQYDYLPWTFGQGTKVEIK. 107
57 -67.100sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  45  2DIVMTQTPSLPVTPGEPASISCRSSQSLLGNTYLNWYLQKAGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEIPYTFGQGTKLEIR. 114
58 -67.100sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  44  1DIQMTQSPSLSASVGDRVTITCQASQDI--NHYLNWYQQGPKKAPKILIYDASNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKLEIK. 107
59 -67.100sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  42  1DIQMTQSPPLSASVGDSVTITCQASQDI--RNSLIWYQQKPGKAPKFLIYDAENLEIGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNLPYTFGQGTKLEIK. 107
60 -67.000sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  48  1DIQMTXPSSLSASVGXRVTITCRASXTI--SSYLXWYXXKPGKAPXLLIYAASXLHSGVPSRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSSPTTFGXGTRLXIK. 107
61 -67.000sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  45  1DVVMTQSPSLPVTLGQPASISCRSSQSSDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWSWTFGQGTKVEIK. 112
62 -67.000sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  48  1DIQMTQSPSLSASVGDRVTITCQASQDI--SIFLNWYQQKPGKAPKLLIYDASKLEAGVPSRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNLPLTFGGGTKVDFK. 107
63 -66.900sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  51  1DIVMTQSPSLAVSLGERATINCKSSQSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP-TFGGGTKVEIK. 112
64 -66.900sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQMTQSPSLSASVGDRVTITCQASQDI--RKHLNWYDQKPGKAPRLLIYGASTLETGVPSRFSGSGSGTDFTLTISTLQPEDIGNYYCQQYDNVPITFGQGTRVENKG 108
65 -66.900sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  44  1EIVLTQSPTLSLSPGESATLSCRASQSV--SSNLAWYQQKRGQSPRLLIRDASSRANGIPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYSTSPYTFGQGTKLEIK. 107
66 -66.800sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  45  1DIQMTQSPSLSASVGDRVTITCQASQDI--IKYLNWYQQTPGKAPKLLIYEASNLQAGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSLPYTFGQGTKLQIT. 107
67 -66.800sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  42  1DIQMTQSPTQPASVGDRVTITCRASQS--INIWLAWYQQKPEKAPKLLIYKASTLETGVPSRFSGSGSGTEFTLTINSLQPDDFATYYCQQYSRYPYTFGQGTKLDIK. 107
68 -66.800sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  49  1DIQMTQSPSLSASVGDRVTITCRASQG--IRNDLTWYQQKPGTAPKRLIYGATSLQSGVPSRFSGSGSGTEFTLTINSLQPEDFATYYCLQYSSFPWTFGQGTKVEVK. 107
69 -66.700sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  43  1DVVMTQSPFLPVTLGEPASIQCRSSQSLVGXTYLXWYLQKPGQSPELLIYLSSYRDSGVPDRFSDSGSGTDFTLKITRVQAEDVGVYYCMQATXSPYTFGQGTKLXIK. 112
70 -66.700sp|P83593|KV405_HUMAN Ig kappa chain V-IV region STH (Fragment) OS=Homo sapiens PE=1 SV=1  ali follow..  50  1DIVMTQSPSLVVSLGERATINCRSSQSVLNKNYLAWYQQKPGQAPKLLFSWASTRESGVPDRFSGSGSGTDFTLTIPGLQAEDVAVYYCQQYYRIPYTFGQGAK..... 109
71 -66.700sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  48  1DIQMTQSPSLSVSVGDRVTITCQASQNV--NAYLNWYQQKPGLAPKLLIYGASTREAGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYNNWPPTFGQGTKVEVK. 107
72 -66.600sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  46  1DIQMTQSPSLSASVGDRVTIICRASQGI--RNDLTWYQQKPGKAPKELIYAASNLQSGVPSRFSGSGAGTEFTLTISSLQPEDFATYYCLQQNSYPRSFGQGTKVEIK. 107
73 -66.500sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  48  1DIQMTQSPSLSASVGDRVTITCRASQDI--TNYVNWFQQRPGQAPKVLIYGASILETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDTLPLTFGGGTKVDIK. 107
74 -66.200sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  43  1DIQMTQSPTLSVSVGDRVTITCEASQT--VLSYLNWYQQKPGKAPKLLIYAASSLETGVPSRFSGQGSGTXFTFTISSVXPXXFATYYCQXYLDLPRTFGQGTKVDLK. 107
75 -66.100sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  48  1EIVMTQSPTLSVSPGERATLSCRASQS--VSNNLAWYQQKPGQPPRLLIYGASTRATGIPARFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNPPWTFGQGTRVEIK. 108

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.