current user: public

If you have questions about the server, please let us know.

Query: sp|P09564|CD7_HUMAN(removed signalp:1-25) T-cell antigen CD7 OS=Homo sapiens GN=CD7 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
3 -50.700sp|Q9H106|SIRPD_HUMAN(removed signalp:1-29) Signal-regulatory protein delta OS=Homo sapiens GN=SIRPD PE=2 SV=2  ali follow..  19  2..HVQQTEMSQTVSTGESIILSCSVPNTPVLWF-KGTGPNRKLIYNFKQGNFPRVKEIGDTT---KPGNTDFSTRIREISLADAGTYYCVKFIKGRQSGRGTQVFVTEQNPR--PPKNRPAGRAGSRAHHDAHTCLS--ALPERNSTNYFVQPCCCL.......................................................... 157
4 -50.600sp|P10966|CD8B_HUMAN(removed signalp:1-18) T-cell surface glycoprotein CD8 beta chain OS=Homo sapiens GN=CD8B PE=1 SV=1  ali follow..  11  1NSVLQQTPAYIKVQTNKMVMLSCEAKNMRIYWLRQRQAPSSDSHHEFSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPETFGKGTQLSVVDFLPTTAQPTKKSTLKKRRPETQKGPLCSPITLGL......................................................................... 157
5 -50.000sp|A6NJW9|CD8BL_HUMAN(removed signalp:1-18) Putative T-cell surface glycoprotein CD8 beta-2 chain OS=Homo sapiens GN=CD8BP PE=5 SV=2  ali follow..  12  1NSVLQQTPAYIKVQTNKMVMLSCEAKISLIYWLRQRQAPSSDSHHEFSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPETFGKGTQLSVVVDFLPTTAQPTKKSTLKKRPETQKGPLCS............................................................................... 152
7 -48.100sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  31  3..QMTQSPSTLSASVGDRVAITCRASQSWLAWYQQKPGKAPKVLIYKSSSLESGVPSRFSG----SGSGTDFTLTISSLXPXXFATYYCQQYNTFFTFGPGTKVDIKR........................................................................................................... 107
8 -48.000sp|P40259|CD79B_HUMAN(removed signalp:1-28) B-cell antigen receptor complex-associated protein beta chain OS=Homo sapiens GN=CD79B PE=1 SV=1  ali follow..  16  15CSRIWQSPRFIARKRGFTVKMHCYMNSANVSWLWKQEMDENPQQLKLE-----------KGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFI.............................................................................. 145
10 -46.800sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  29  3..VMTQSPDSLAVSLGERATINCKSSQSYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSG----SGSGTDFTLTISSLQAEDVAVYYCQQYDTIPTFGGGTKVEIK............................................................................................................ 112
11 -46.500sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  31  3..QMTQSPSSLSASVGDRVTITCRASQNYVNWFQQRPGQAPKVLIYGASILETGVPSRFSG----SGSGTDFTFTISSLQPEDIATYYCQQYDTLPTFGGGTKVDIKR........................................................................................................... 108
12 -46.500sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  32  3..QMTQSPSTLSASVGDRVTITCRASQSWLAWYQQKPGKAPKLLMYKASSLESGVPSRFIG----SGSGTEFTLTISSLQPDDFATYYCQQYNSDSMFGQGTKVEVKG........................................................................................................... 108
13 -46.400sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  25  3..VLTQSPGTLSLSPGESATLSCRASQSNLAWYQQKRGQSPRLLIRDASSRANGIPDRFSG----SGSGTDFTLIISRLEPEDFAVYYCQQYSTSPTFGQGTKLEIKR........................................................................................................... 108
14 -46.300sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  33  3..QMTQSPSSLSASVGDRVTITCQASQDHLNWYDQKPGKAPRLLIYGASTLETGVPSRFSG----SGSGTDFTLTISTLQPEDIGNYYCQQYDNVPTFGQGTRVENKG........................................................................................................... 108
15 -46.300sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  27  3..VLTQSPLSLPVTPGEPASISCRSSQXYLDWYLXKPGXSPXLLIYLGSNR----ASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQTPTFGGGTNVEIKR........................................................................................................... 112
16 -46.300sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  29  3..QMTQSPSSLSASVGDRVIITCRASQDYLNWYQQKPGKAPKLLIFDTSNLQSGVPSRFSG----GRSGTDFTLTISSLQPDDFATYYCQQSYTNPTFGGGTTVDIKR........................................................................................................... 109
17 -46.100sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  31  3..QMTQSPSSLSASVGDRVTITCRASQSYLNWYQQKPGKAPKLLIYAASSLQSGVTSRFSG----SGSGTDFTLTISSLQPEDSATYYCQQSYSTLTFGQGTRLEIK............................................................................................................ 107
18 -46.100sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  31  3..QMTQSPSPLSASVGDSVTITCQASQDSLIWYQQKPGKAPKFLIYDAENLEIGVPSRFRG----SGSGTDFALSISSLQPEDFATYYCQQYYNLPTFGQGTKLEIKR........................................................................................................... 108
19 -46.100sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  32  3..QMTQSPSSLSASVGDRVTITCQASQDYLNWYQQTPGKAPKLLIYEASNLQAGVPSRFSG----SGSGTDYTFTISSLQPEDIATYYCQQYQSLPTFGQGTKLQITR........................................................................................................... 108
20 -46.100sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  31  3..QMTQSPSSLSASVGDRVTITCQASQDFLNWYQQKPGKAPKLLIYDASKLEAGVPSRFSG----TGSGTDFTFTISSLQPEDIATYYCQQFDNLPTFGGGTKVDFKR........................................................................................................... 108
21 -46.100sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  33  3..QMTQSPSSVSASVGDRVTITCRASQDWLAWYQQKSGKAPKLLIYSASSLENGVPSRFSG----SGSGTEFTLTISSLQPEDFATYFCQQAHSVPTFGGGTTVDIKR........................................................................................................... 108
22 -46.100sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  30  3..XMTQSPSSLSASVGDRVTITCRAGQSYLNWYQQKPGKAPKVLIFAASSLKSGVPSRFSG----SGSGTDFTLTISGLLPEDFATYYCQQSYTTPTFGPGTKVEMTR........................................................................................................... 108
23 -46.100sp|P01708|LV205_HUMAN Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  26  1.QSALTQPRSVSGSPGHSVTISCIGTSKYVSWYQQHPGKAPKLIIYEVSSR----PSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYIGSYVFGTGTKVIVLG........................................................................................................... 109
24 -46.000sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  26  5DIVMTQSPLSLPVTPGEPASISCRSSQSYLDWYLQKPQQSPQLLIYLGSNR----ASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQTPTFGQGTKVEIK............................................................................................................ 116
25 -46.000sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  25  3..VMTQSPLSLPVTPGEPASISCRSSQSYLNWYLQKPGQSPXLLIYALSNR----ASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQAPIFGQGTRLEIKR........................................................................................................... 113
26 -46.000sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  30  3..QMTQSPSSLSASVGDRVTIICRASQGDLTWYQQKPGKAPKELIYAASNLQSGVPSRFSG----SGAGTEFTLTISSLQPEDFATYYCLQQNSYPSFGQGTKVEIKR........................................................................................................... 108
27 -46.000sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  28  3..VMTQSPDSLAVSLGERATINCKSSQNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSG----SGSGTDFTLTISSLQAEDVAVYYCQQYYSTPSFGQGTKLEIKR........................................................................................................... 114
28 -46.000sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  33  3..QMTQSPSSLSVSVGDRVTITCQASQNYLNWYQQKPGLAPKLLIYGASTREAGVPSRFSG----SGSGTDFTFTISSLQPEDIATYYCQQYNNWPTFGQGTKVEVKR........................................................................................................... 108
29 -46.000sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  31  3..QMTQSPSSLSASVGDRVTITCRAGHNFLSWYQQKPGKAPTLLIYAVSNLQVGVPSRFSG----SGSGAEFTLTISSLQPEDFATYYCQQNYNFSTFGGGTKVDNK............................................................................................................ 107
30 -46.000sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  32  3..QMTQSPSSLSASVGDRVTITCRASQNDLTWYQQKPGTAPKRLIYGATSLQSGVPSRFSG----SGSGTEFTLTINSLQPEDFATYYCLQYSSFPTFGQGTKVEVK............................................................................................................ 107
31 -46.000sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  26  3..VMTQSPLSLPVTLGQPASISCRSSQSYLNWFQQRPGQSPRRLIYKVSNR----DSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWSTFGQGTKVEIKR........................................................................................................... 113
32 -45.900sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  31  3..QMTQSPSTLSVSVGDRVTITCEASQSYLNWYQQKPGKAPKLLIYAASSLETGVPSRFSG----QGSGTXFTFTISSVXPXXFATYYCQXYLDLPTFGQGTKVDLK............................................................................................................ 107
33 -45.900sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  29  3..QMTQSPSSLSASVGDRVTITCQASQDYLNWYQQGPKKAPKILIYDASNLETGVPSRFSG----SGFGTDFTFTISGLQPEDIATYYCQQYDTLPTFGQGTKLEIKR........................................................................................................... 108
34 -45.900sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  33  3..QMTQSPSSLSASVGDRVTITCRASQSYLSWYQQKPGKAPQVLIYAASSLPSGVPSRFSG----SGSGTDFTLTISSLQPEDFATYYCQQNYITPSFGQGTRVEIKR........................................................................................................... 108
35 -45.900sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  28  3..VMTQSPLFLPVTLGEPASIQCRSSQSYLXWYLQKPGQSPELLIYLSSYRDSGVPDRFSD----SGSGTDFTLKITRVQAEDVGVYYCMQATXSPYFGQGTKLXIKR........................................................................................................... 113
36 -45.800sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  27  3..VLTQSPGTLSLSPGERATLSCRASQSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSG----SGSGTDFTLTISRLEPXDFAVYYCQQYGSSPTFGQGTKVEIK............................................................................................................ 108
37 -45.800sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  29  3..QLTQSPSSLSASVGDRVTITCRASQNYVAWFQQKPGKAPKSLIYDASTLQSGVPSNFTG----SGSGTDFILTISSLQPEDFATYYCQQYNSYPTFGQGTKVQIKR........................................................................................................... 108
38 -45.800sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  30  3..QMTQSPSTQPASVGDRVTITCRASQSWLAWYQQKPEKAPKLLIYKASTLETGVPSRFSG----SGSGTEFTLTINSLQPDDFATYYCQQYSRYPTFGQGTKLDIKR........................................................................................................... 108
39 -45.700sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  32  3..QMTXSPSSLSASVGXRVTITCRASXTYLXWYXXKPGKAPXLLIYAASXLHSGVPSRFSG----SGSGTXFTFTISSLXPXXFATYYCXXSYSSPTFGXGTRLXIKR........................................................................................................... 108
40 -45.700sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  31  3..QMTQSPSSLSASVGDRVTITCQASQDYLNWYQQKPGKAPKLLIYDASNLESGVPSRFSG----GGSGAHFTFTISSLQPEDIATYYCQQYDYLPTFGQGTKVEIKR........................................................................................................... 108
41 -45.700sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  26  3..VLTQSPGTLSLSPGERATLSCRAALGYLAWYQQKPGQAPRLLMYGASSRATGIPDRFSG----SGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSFGQGTKVEIK............................................................................................................ 108
42 -45.500sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  29  3..VMTQSPDSLAVSLGERATINCKSSQSYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSG----SGSGTDFTLTISSLQAEDVAVYYCQQYYNLPTFGQGTKVEIKR........................................................................................................... 114
43 -45.400sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  27  4..VMTQTPLSLPVTPGEPASISCRSSQSYLNWYLQKAGQSPQLLIYTLSYR----ASGVPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEIPTFGQGTKLEIR............................................................................................................ 114
44 -45.400sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  25  1.QSVLTQPPSVSGTPGQRVTISCSGGSSYVYWYQQLPGTAPKLLIYRDDKR----PSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRLVFGGGTQLTVLR........................................................................................................... 112
45 -45.400sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  28  3..VLTQSPGTLSLSPGERATLSCRASQSVLGWYQQKPGQAPRLLIYGASSRATGIPDRFSG----SGSGTDFTLTISRLEPEDFAVYYCQQYGSLGTFGQGTKVEIKR........................................................................................................... 109
46 -45.300sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  26  3..VLTQSPGTLSLSPGERATLSCRASQSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSG----SGSGTDFTLTISRLEPDDFAVYYCQQYGSSPTFGQGSKVEIK............................................................................................................ 108
47 -45.300sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  27  1.QSVLTQPPSASGTPGGRVTISCSGSSXPAYWYQQLPGTAPKLLIYNYNQR----PSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSLVFGTGTKVTVLR........................................................................................................... 112
48 -45.300sp|P04435|TVB2_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region CTL-L17 OS=Homo sapiens GN=TCRB PE=2 SV=1  ali follow..  20  2...VSQNPRHNITKRGQNVTFRCDPISERLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERKGSFSTLEIQRTEQGDSAMYLCASSLAGLHFGDGTRLSI............................................................................................................. 111
49 -45.200sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  22  2TFYELTQPPSVSLAAGQTAMITCEGNDRSVHWYQQKPGQAPVPVIYDDADR----PSGVPARFSGYNSGNSAILTINRVEAGDEADYFCQSWDNGSVFGTGTMVTVLG........................................................................................................... 111
50 -45.200sp|P03979|TVC_HUMAN(removed signalp:1-17) T-cell receptor gamma chain V region PT-gamma-1/2 OS=Homo sapiens GN=TRGV3 PE=2 SV=1  ali follow..  23  2SSNLEGRTKSVTRQTGSSAEITCDLTTFYIHWYLHQEGKAPQRLLYYDVSTARDVLES-GKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRXKLFGSGTTLVVT............................................................................................................ 119
51 -45.200sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  26  1.QSALTQPRSVSGSPGQSLTISCSGAPCSVSWYQQHPGKAPKLIIYGFSNR----PSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADSSVFGAGTKLTVLR........................................................................................................... 110
52 -45.200sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  29  3..VMTQSPATLSVSPGERATLSCRASQNNLAWYQQKPGQPPRLLIYGASTRATGIPARFSG----SGSGTEFTLTISRLQSEDFAVYYCQQYNNWPTFGQGTRVEIK............................................................................................................ 108
53 -45.100sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  27  3..VLTQSPGTLSLSPGERATLSCRASQSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSG----SGSGTDFTLTISRLEPEDFAVYYCQQYGTSPTFGQGTKVEIK............................................................................................................ 108
54 -45.000sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  27  1SYELTQPP-SVSVSPGQTARITCSANAQYAYWYQQKPGRAPVMVIYKDTQR----PSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNSAIFGGGTKLTVLG........................................................................................................... 107
55 -45.000sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  25  2...VLTQPPSVSVAPGETARLTCGGNDESVHWYQQKPGQAPVLVIYFDRDRPSGIPERFSG----SNSGNTATLTISRVEAGDEADYYCQLWDSSSVFGGGTKLTVLSQPK........................................................................................................ 111
56 -45.000sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  25  1.QSALTQPASVSGSPGQSITISCTGTTDFVSWYQQHPGKAPKLLIYDVNSR----PSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTTNVFGGGTKLSVLG........................................................................................................... 112
57 -45.000sp|P01733|TVB1_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region YT35 OS=Homo sapiens GN=TRBV12-3 PE=1 SV=1  ali follow..  21  2...VIQSPRHEVTEMGQEVTLRCKPISGSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASSTLKIQPSEPRDSAVYFCASSFSTYTFGSGTRLTVV............................................................................................................ 114
58 -45.000sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  27  3..VLTQSPGTLSLSPGERATLSCRASQSFLAWYQQKPGQAPRLLIYVASSRATGIPDRFSG----SGSGTDFTLTISRLEPEDFAVYYCQQYGSSSTFGQGTKVELK............................................................................................................ 108
59 -44.900sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  26  1.QSVLTQPPSLSAAPGQRVSISCSGSSSYVDWYQQLPGTAPKLLIFNNNKR----PSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNRRVFGGGTNVTVVG........................................................................................................... 109
60 -44.900sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  27  3..VMTQSPVTLSVSPGERATLSCRASQSYLAWYQQKPSGSPRLLIYGASTRATGIPARFSG----SGSGTEFTLTISSLQSEDFAVYYCQQYNNWPTFGQGTRVEIK............................................................................................................ 108
61 -44.800sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  22  2...VLSQPPSVSVAPGQTARITCGGDGKSVHWYQQKPGQAPVLVVHEDNDR----PAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRTVFGGGTKLTVLG........................................................................................................... 108
62 -44.800sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  25  1.QSVLTQPPSVSAAPGQKVTISCSGGSNYVSWHQHLPGTAPKLLIYEDNKR----PSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSLVFGGGTKVTVLG........................................................................................................... 111
63 -44.700sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.HSALTQPASVSGSLGQSITISCTGTSSYVSWFQQHPGTAPKLIISEVRNR----PSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYTSSNVFGGGTKLTVLG........................................................................................................... 111
64 -44.700sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  24  3..VLTXSPGTLSLSPGXRAALSCRASQSYLAWYQQKPGQAPRLLMYGVSSRATGIPDRFSG----SGSGADFTLTISRLXPEDFAVYYCQQYGSSFTFGQGSKLEIK............................................................................................................ 108
65 -44.700sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  22  1.QSALTQPRSVSGSPGQSVTISCTGTSSSVSWYQQHPGKAPKLMIFDVTKR----PSGVPDRLSGSKSGDTASLTISGLRADDEADYYCCSYAGRVIFGGGTKLTVLG........................................................................................................... 111
66 -44.600sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.ASALTQPRSLSGSPGQAVTISCTGLPSFVSWYQQTPGRAPRLLIYDDSLR----PSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGNYVFGQGTDLTVLG........................................................................................................... 111
67 -44.600sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  24  1.QSVLTQPPSASGTPGQRVTISCFGSSSYVYWYQQLPGTTPKLLIYKDNQR----PSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLVFGGGTTLTVLS........................................................................................................... 109
68 -44.600sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  26  1.QSVLTQPPSVSAAPGQKVTISCSGSSSYVSWYQQVPGTAPKLLIYDNNKR----PSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSLVFGGGTKLTVLG........................................................................................................... 111
69 -44.500sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  22  3..QMTQSPSSLSATVGDRVTLLCEASQSFLAWYQQKPKKAPKLLIYDASNLETGV----PSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLSTFGVASKVESK............................................................................................................ 111
70 -44.500sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  26  1.QSVLTQPPSVSAAPGQEVTISCSGSDNFVSWYQQLPGTAPKLLIYDNNKR----PSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLMFGGGTRVTVLG........................................................................................................... 111
71 -44.500sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  25  1.QSALTQPRSVSGSPGQSVTISCAGTSSFVSWYQQHPGKAPKLIIYGVNKR----PSGVPYRFSGSKSGNTASLTISGLQAEDEAHYYCCSYAGRWVFGGGTNLTVLG........................................................................................................... 111
72 -44.500sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  26  1.QSALTQPPSASGSLGQSVTISCTGTSNYVSWYQQHAGKAPKVIIYEVNKR----PSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDVFGTGTKVTVLG........................................................................................................... 111
73 -44.500sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  24  1.QSALTQPASVSGSPGQSITISCTGTTNFVSWYQQNPGKAPKLMIYEGNKR----PSGVSNRFSGSKSGKTASLTISGLQVEDEADYYCCSYAGNRVFGGGTRVTVLS........................................................................................................... 111
74 -44.300sp|P04437|TVA2_HUMAN(removed signalp:1-21) T-cell receptor alpha chain V region CTL-L17 OS=Homo sapiens GN=TCRA PE=2 SV=1  ali follow..  22  6DQQVKQNSPSLSVQEGRISILNCDYTNSYFLWYKKYPAEGPTFLISISSIKDKNEDGRFT--VFLNKSAKHLSLHIVPSQPGDSAVYFCAAKGAGTTFGTGTRLQVT............................................................................................................ 117
75 -44.300sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  24  1.QSALTQPPRVSGSPGQSVTISCTGSYSHVSWYQQDPGKVPKLMIYDVDKR----PSGVPDRFSGSKSANTASLTISGLQANNEADYYCSSYGGTYIFGGGTKLTVLG........................................................................................................... 111

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 4 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.