current user: public

If you have questions about the server, please let us know.

Query: sp|P16949|STMN1_HUMAN Stathmin OS=Homo sapiens GN=STMN1 PE=1 SV=3, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEADLast
1 -82.100sp|P16949|STMN1_HUMAN Stathmin OS=Homo sapiens GN=STMN1 PE=1 SV=3  ali  100  1MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD 149
2 -74.600sp|Q9H169|STMN4_HUMAN Stathmin-4 OS=Homo sapiens GN=STMN4 PE=2 SV=1  ali follow..  69  45CVISDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEEASR.... 189
3 -74.200sp|Q93045|STMN2_HUMAN Stathmin-2 OS=Homo sapiens GN=STMN2 PE=1 SV=3  ali follow..  69  35YTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELS..... 178
4 -72.400sp|Q9NZ72|STMN3_HUMAN Stathmin-3 OS=Homo sapiens GN=STMN3 PE=2 SV=3  ali follow..  64  35YQYGDMEVKQLDKRASGQSFEVILKSPSDLSPSPMLSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHKALEENNNFSRQAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREE....... 177
5 -9.040sp|Q9BY12|SCAPE_HUMAN S phase cyclin A-associated protein in the endoplasmic reticulum OS=Homo sapiens GN=SCAPER PE=1 SV=1  ali   17  97..................................................EEKQMKAQQLREKLREEKTLKLQKLLEREKDVRKWKEELLDQ----RRRMMEEKLLHAEFKREVQLQAIVKKAQEEEAKVNEIAFINTLEAQNKRHDVL 191
6 -8.940sp|Q9Y6V0|PCLO_HUMAN Protein piccolo OS=Homo sapiens GN=PCLO PE=1 SV=3  ali   16  134....................................IVPEEDKQQQQLDLERELLELEKIKQQRFAEELEWERQEIQRFREQEKIMVQKKLEELQSMKQHLLFQQE---EERQAQFMMRQETLAQQQLQLEQIQQLQQQLHQQLEEQ.. 241
7 -8.740sp|Q96T17|MA7D2_HUMAN MAP7 domain-containing protein 2 OS=Homo sapiens GN=MAP7D2 PE=1 SV=2  ali   21  52..................................................DERQRLAKERREERE----KCLAAREQQILEKQKRARLQYEKQMEERWRKLEEQRQREDQKRAAVEEKRKQKLREEEERLEAMRRSLERTQQLELKK.. 145
8 -8.670sp|Q9NVL8|CN105_HUMAN Uncharacterized protein C14orf105 OS=Homo sapiens GN=C14orf105 PE=2 SV=2  ali follow..  78................DMYFDIIIKRHPPQRLQKLEPIDLPRVITSGRLLSQREARTMHKAKQVLEKKMQTPMYTSENRQYLHKMQVLEMIRKRQEAQMEL---------KKSLHGEARINKQSPRDHKAKKTLQSTPRNDDHDLLTML 209
9 -8.620sp|Q9BY12|SCAPE_HUMAN S phase cyclin A-associated protein in the endoplasmic reticulum OS=Homo sapiens GN=SCAPER PE=1 SV=1  ali   17  61.............................................RQEEKQARDEAVQERKRALEAERQARVEELLMKIEQQRQEKEKAREDAARERARDREERLAALTAAQQEAMEELQKKIQLHMEQIEQRKEK............. 166
10 -8.160sp|Q14244|MAP7_HUMAN Ensconsin OS=Homo sapiens GN=MAP7 PE=1 SV=1  ali   20  62................................................RVDDRQRLARERREEREAAREIVWLEREERARQHYEKHLEERKKRLEEQRQKEERRRAAVEEKRRQRLEEDKERHEAVVRRTMERSQKPKQKHNR...... 159

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.