current user: public

If you have questions about the server, please let us know.

Query: sp|P40259|CD79B_HUMAN(removed signalp:1-28) B-cell antigen receptor complex-associated protein beta chain OS=Homo sapiens GN=CD79B PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
3 -48.000sp|P09564|CD7_HUMAN(removed signalp:1-25) T-cell antigen CD7 OS=Homo sapiens GN=CD7 PE=1 SV=1  ali follow..  16  1..............AQEVQQSPHCTTVPVGASVNITCSTSGG--LRGIYLRQLGPQPQDIIYYERGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVN---VYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALP........................................................ 137
6 -46.600sp|P10966|CD8B_HUMAN(removed signalp:1-18) T-cell surface glycoprotein CD8 beta chain OS=Homo sapiens GN=CD8B PE=1 SV=1  ali follow..  19  1..............NSVLQQTPAYIKVQTNKMVMLSCEAKISNMRIYWLRQRQAPSSDSHHEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSP--ELTFGKGTQLSVVDFLPTTAQPTKKSTLKKPRPETQKGPLCSPITLGLLV................................................. 159
7 -46.400sp|A6NJW9|CD8BL_HUMAN(removed signalp:1-18) Putative T-cell surface glycoprotein CD8 beta-2 chain OS=Homo sapiens GN=CD8BP PE=5 SV=2  ali follow..  18  1..............NSVLQQTPAYIKVQTNKMVMLSCEAKISLSNIYWLRQRQAPSSDSHHEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSP--ELTFGKGTQLSVVVDFLPTTATLKKRVCRLPRPETQKGPLCSPVTLGLLV................................................. 160
8 -45.200sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  24  2.................VLTQPPSVSVAPGETARLTCGGNDGSESVHWYQQKPGQAPVLVIYFDPERFSGSNSGNTATLTISRVEAGDEADYYCQLWDSSSEHVVFGGGTKLTVLSQPK.................................................................................. 111
9 -44.800sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  20  1..............EIVLTQSPGTLSLSPGESATLSCRASQSVSSLAWYQQKRGQSPRLLIRDAPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYSTS--PYTFGQGTKLEIKR..................................................................................... 108
10 -44.800sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  23  2.................VLSQPPSVSVAPGQTARITCGGDGGGKSVHWYQQKPGQAPVLVVHEDPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRTAHVVFGGGTKLTVLG..................................................................................... 108
11 -44.700sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............DIQMTQSPSSLSASVGDRVTITCRASQDITNVNWFQQRPGQAPKVLIYGAPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDTL--PLTFGGGTKVDIKR..................................................................................... 108
12 -44.600sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  23  1..............DVQMTQSPSSLSASVGDRVIITCRASQSSVDLNWYQQKPGKAPKLLIFDTPSRFSGGRSGTDFTLTISSLQPDDFATYYCQQSYTNP-EVTFGGGTTVDIKR..................................................................................... 109
13 -44.600sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............DIQMTQSPSSVSASVGDRVTITCRASQDISHLAWYQQKSGKAPKLLIYSAPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQAHSV--PLTFGGGTTVDIKR..................................................................................... 108
14 -44.600sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  20  1..............EIVLTQSPGTLSLSPGERATLSCRASQSSSYLAWYQQKPGQAPRLLIYGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSS--PWTFGQGTKVEIKR..................................................................................... 109
15 -44.500sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  24  1...............QSVLTQPPSVSGTPGQRVTISCSGGSSNNYVYWYQQLPGTAPKLLIYRDPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRLSAVVFGGGTQLTVLR..................................................................................... 112
16 -44.500sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  21  1..............EIVLTQSPGTLSLSPGERATLSCRAALSRGYLAWYQQKPGQAPRLLMYGAPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSS--PRSFGQGTKVEIKR..................................................................................... 109
17 -44.400sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  20  1..............DIQMTQSPSSLSASVGDRVTITCQASQDISILNWYQQKPGKAPKLLIYGVPSRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNL--PLTFGGGTKVDFKR..................................................................................... 108
18 -44.400sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  19  1...............QSVLTQPPSASGTPGGRVTISCSGSSSNXPAYWYQQLPGTAPKLLIYNYPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSLDGYVFGTGTKVTVLR..................................................................................... 112
19 -44.300sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............DIQMTQSPSPLSASVGDSVTITCQASQDIRNLIWYQQKPGKAPKFLIYGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNL--PYTFGQGTKLEIKR..................................................................................... 108
20 -44.300sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............XIXMTQSPSSLSASVGDRVTITCRAGQSVNKLNWYQQKPGKAPKVLIFAAPSRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTT--PYTFGPGTKVEMTR..................................................................................... 108
21 -44.300sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  21  1..............DIQMTQSPSSLSASVGDRVTITCQASQDIIKLNWYQQTPGKAPKLLIYEAPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSL--PYTFGQGTKLQITR..................................................................................... 108
22 -44.300sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  23  1..............DIQMTQSPSSLSASVGDRVTITCRASQSISNLNWYQQKPGKAPKLLIYAATSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYST--LITFGQGTRLEIK...................................................................................... 107
23 -44.300sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  21  1..............DIQMTQSPSSLSASVGDRVTIICRASQGIRNLTWYQQKPGKAPKELIYGVPSRFSGSGAGTEFTLTISSLQPEDFATYYCLQQNSY--PRSFGQGTKVEIKR..................................................................................... 108
24 -44.300sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............DVVMTQSPLFLPVTLGEPASIQCRSSQSXTYLXWYLQKPGQSPELLIYLSPDRFSDSGSGTDFTLKITRVQAEDVGVYYCMQATXS--PYTFGQGTKLXIKR..................................................................................... 113
25 -44.200sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  19  1..............DVVMTQSPLSLPVTLGQPASISCRSSQSNTYLNWFQQRPGQSPRRLIYKVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHW--SWTFGQGTKVEIKR..................................................................................... 113
26 -44.200sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  19  1..............DIQMTQSPSTLSASVGDRVAITCRASQNISSLAWYQQKPGKAPKVLIYKSPSRFSGSGSGTDFTLTISSLXPXXFATYYCQQYNTF---FTFGPGTKVDIKR..................................................................................... 107
27 -44.200sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............DIQMTQSPSTLSASVGDRVTITCRASQSINTLAWYQQKPGKAPKLLMYKAPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSD--SKMFGQGTKVEVKG..................................................................................... 108
28 -44.200sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  20  1..........GSSGDIVMTQSPLSLPVTPGEPASISCRSSQGYNYLDWYLQKPQQSPQLLIYLGPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQT--PQTFGQGTKVEIKR..................................................................................... 117
29 -44.200sp|P01703|LV105_HUMAN Ig lambda chain V-I region NEWM OS=Homo sapiens PE=1 SV=1  ali follow..  25  1...............QSVLTQPPSVSGAPGQRVTISCTGSSAGNHVKWYQQLPGTAPKLLIFHNNARFSVSKSGSSATLAITGLQAEDEADYYCQSYDRS--LRVFGGGTKLTVLR..................................................................................... 103
30 -44.200sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  24  1..............DIQMTQSPSSLSASVGDRVTITCQASQDIRKLNWYDQKPGKAPRLLIYGVPSRFSGSGSGTDFTLTISTLQPEDIGNYYCQQYDNV--PITFGQGTRVENKG..................................................................................... 108
31 -44.200sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............DIQMTQSPSSLSVSVGDRVTITCQASQNVNALNWYQQKPGLAPKLLIYGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYNNW--PPTFGQGTKVEVKR..................................................................................... 108
32 -44.200sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............DIQMTQSPSSLSASVGDRVTITCRASQSISSLSWYQQKPGKAPQVLIYGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYIT--PTSFGQGTRVEIKR..................................................................................... 108
33 -44.200sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  22  1..............DIVMTQSPDSLAVSLGERATINCKSSQSKNYLAWYQQKPGQPPKLLIYWAPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYST--PYSFGQGTKLEIKR..................................................................................... 114
34 -44.200sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............DIQMTQSPSSLSASVGDRVTITCRASQGIRNLTWYQQKPGTAPKRLIYGAPSRFSGSGSGTEFTLTINSLQPEDFATYYCLQYSSF--PWTFGQGTKVEVKR..................................................................................... 108
35 -44.100sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  16  1..............DIQMTQSPSTLSVSVGDRVTITCEASQTVLSLNWYQQKPGKAPKLLIYAAPSRFSGQGSGTXFTFTISSVXPXXFATYYCQXYLDLP--RTFGQGTKVDLKR..................................................................................... 108
36 -44.100sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............EIVLTQSPGTLSLSPGERATLSCRASQSSGYLGWYQQKPGQAPRLLIYGAPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSL--GRTFGQGTKVEIKR..................................................................................... 109
37 -44.100sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  22  1..............DIQMTQSPSSLSASVGDRVTITCQASQDINHLNWYQQGPKKAPKILIYGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTL--PRTFGQGTKLEIKR..................................................................................... 108
38 -44.100sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  19  1..............DIVMTQSPLSLPVTPGEPASISCRSSQGFDYLNWYLQKPGQSPXLLIYALPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQA--PITFGQGTRLEIKR..................................................................................... 113
39 -44.100sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  21  1..............DIQMTQSPSTQPASVGDRVTITCRASQSINILAWYQQKPEKAPKLLIYKAPSRFSGSGSGTEFTLTINSLQPDDFATYYCQQYSRY--PYTFGQGTKLDIKR..................................................................................... 108
40 -44.100sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  24  1..............DIQMTQSPSSLSASVGDRVTITCRAGHNITNLSWYQQKPGKAPTLLIYGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNF--SFTFGGGTKVDNK...................................................................................... 107
41 -44.000sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  18  1..............DIVLTQSPLSLPVTPGEPASISCRSSQXGXYLDWYLXKPGXSPXLLIYLGPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQT--PLTFGGGTNVEIKR..................................................................................... 112
42 -43.900sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  19  1..............DIQMTQSPSSLSASVGDRVTITCQASQDISDLNWYQQKPGKAPKLLIYDAPSRFSGGGSGAHFTFTISSLQPEDIATYYCQQYDYL--PWTFGQGTKVEIKR..................................................................................... 108
43 -43.800sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  18  1..............EIVLTQSPGTLSLSPGERATLSCRASQSNSYLAWYQQKPGQAPRLLIYGAPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSS--PQTFGQGSKVEIKR..................................................................................... 109
44 -43.800sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  23  1...............QSALTQPASVSGSPGQSITISCTGTTGYDFVSWYQQHPGKAPKLLIYDVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTTNSRAVFGGGTKLSVLG..................................................................................... 112
45 -43.800sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  18  1..............DIQMTXSPSSLSASVGXRVTITCRASXTISSLXWYXXKPGKAPXLLIYGVPSRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSS--PTTFGXGTRLXIKR..................................................................................... 108
46 -43.700sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  21  1..............DIQLTQSPSSLSASVGDRVTITCRASQSVYNVAWFQQKPGKAPKSLIYDAPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSY--PYTFGQGTKVQIKR..................................................................................... 108
47 -43.700sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  24  2..............TFYELTQPPSVSLAAGQTAMITCEGNDGERSVHWYQQKPGQAPVPVIYDDPARFSGYNSGNSAILTINRVEAGDEADYFCQSWDNGSYEVVFGTGTMVTVLG..................................................................................... 111
48 -43.700sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  22  1..............DIVMTQSPDSLAVSLGERATINCKSSQNKNYLAWYQQKPGQPPKLLIYWAPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNL--PWTFGQGTKVEIKR..................................................................................... 114
49 -43.600sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  19  2..............DIVMTQTPLSLPVTPGEPASISCRSSQSNTYLNWYLQKAGQSPQLLIYTLPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEI--PYTFGQGTKLEIRR..................................................................................... 115
50 -43.600sp|P01732|CD8A_HUMAN(removed signalp:1-21) T-cell surface glycoprotein CD8 alpha chain OS=Homo sapiens GN=CD8A PE=1 SV=1  ali follow..  17  1...............SQFRVSPLDRTWNLGETVELKCQVLLSNPTCSWLFQPRGAAASPTFGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNS--IMYFSHFVPVFLPAKPTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAV.................................................. 151
51 -43.600sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  24  1...............QSVLTQPPSVSAAPGQKVTISCSGGSGNNYVSWHQHLPGTAPKLLIYEDPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSLNAVVFGGGTKVTVLG..................................................................................... 111
52 -43.500sp|P04435|TVB2_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region CTL-L17 OS=Homo sapiens GN=TCRB PE=2 SV=1  ali follow..  23  2.................VSQNPRHNITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQSDRFSAERKGSFSTLEIQRTEQGDSAMYLCASSLAGLNQQHFGDGTRLSIL...................................................................................... 112
53 -43.400sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  22  1..............EIVMTQSPATLSVSPGERATLSCRASQSVSNLAWYQQKPGQPPRLLIYGIPARFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNWPPWT-FGQGTRVEIKR..................................................................................... 109
54 -43.400sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  25  1...............QSVLTQPPSVSAAPGQKVTISCSGSSGNDYVSWYQQVPGTAPKLLIYDNPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSLSGWVFGGGTKLTVLG..................................................................................... 111
55 -43.300sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  23  1...............QSVLTQPPSVSAAPGQEVTISCSGSSGDNFVSWYQQLPGTAPKLLIYDNPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSVGMFGGGTRVTVLG..................................................................................... 111
56 -43.200sp|P01733|TVB1_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region YT35 OS=Homo sapiens GN=TRBV12-3 PE=1 SV=1  ali follow..  25  2.................VIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNEDRFSAKMPNASSTLKIQPSEPRDSAVYFCASSFSTCSAYTFGSGTRLTVV...................................................................................... 114
57 -43.000sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  24  1................SELTQDPAVSVALGQTVRITCQGDSRGYDAAWYQQKPGQAPLLVIYGRPDRFSGSSSGHTASLTITGAQAEDEADYYCNSRDSSGKHVLFGGGTKLTVLG..................................................................................... 108
58 -43.000sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  21  1..............EIVLTQSPGTLSLSPGERATLSCRASQSSSYLAWYQQKPGQAPRLLIYGAPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTSPR--TFGQGTKVEIKR..................................................................................... 109
60 -42.700sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  21  1..............EIVLTQSPGTLSLSPGERATLSCRASQSNSFLAWYQQKPGQAPRLLIYVAPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPS--TFGQGTKVELKR..................................................................................... 109
61 -42.600sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  21  1..............EIVMTQSPVTLSVSPGERATLSCRASQSNSYLAWYQQKPSGSPRLLIYGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPP--TFGQGTRVEIKR..................................................................................... 109
62 -42.500sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  21  1..............DIVMTQSPDSLAVSLGERATINCKSSQNKNYLAWYQQKPGQPPKLLIYWAPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP---TFGGGTKVEIKR..................................................................................... 113
63 -42.500sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  24  2.................DLTQPPSVSVSPGQTASITCSGDKGDKDVCWYQQRPGQSPVLVIYQDPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSM--SVVFGGGTRLTVLS..................................................................................... 106
65 -42.400sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  18  1..............DIQMTQSPSSLSATVGDRVTLLCEASQGNTFLAWYQQKPKKAPKLLIYGVPSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLPS--TFGVASKVESKR..................................................................................... 112
66 -42.400sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  19  1..............XIVLTXSPGTLSLSPGXRAALSCRASQSGNYLAWYQQKPGQAPRLLMYGVPDRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSSPF--TFGQGSKLEIK...................................................................................... 108
67 -42.300sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  23  1...............QSALTQPRSVSGSPGQSLTISCSGAPGCESVSWYQQHPGKAPKLIIYGFPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADS--SVIFGAGTKLTVLR..................................................................................... 110
68 -42.200sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  25  2.................ALTQPPSVSVSPGQTAVITCSGDNEKTFVSWFQQRPGQSPLLVIYHTPERFSGSSSGATATLTISGAQSVDEADYFCQTWDTI--TAIFGGGTKLTVLS..................................................................................... 106
69 -42.000sp|P01715|LV401_HUMAN Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1  ali follow..  25  2.................GLTQPPSLSVSPGQTASITCSGDKGEQYVCWYQQKPGQSPVLVIYHDPERFSGSNSGTTATLTISGTQAMDEADYYCQAWDSY--TVIFGGGTKLTVLG..................................................................................... 106
70 -42.000sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  20  1...............QSVLTQPPSASGTPGQRVTISCSGGNGRNSVNWYQVHPGTAPRLLIYSSPDRFSGSKSGTSASLAISGLQSENEADYFCATWDDSLDGPVFGGGTKVTVLG..................................................................................... 111
71 -42.000sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  25  1..............SYELTQ-PPSVSVSPGQTARITCSANAPNQYAYWYQQKPGRAPVMVIYKDPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNS--ASIFGGGTKLTVLG..................................................................................... 107
72 -41.800sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  25  1...............ASALTQPRSLSGSPGQAVTISCTGLPSDNFVSWYQQTPGRAPRLLIYDDPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGN-YIFVFGQGTDLTVLG..................................................................................... 111
73 -41.800sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  24  1...............HSALTQPASVSGSLGQSITISCTGTSGYNYVSWFQQHPGTAPKLIISEVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYTSSN-SVVFGGGTKLTVLG..................................................................................... 111
74 -41.700sp|P01737|TVA3_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region PY14 OS=Homo sapiens PE=1 SV=1  ali follow..  20  1...............QSVTQLGSHVSVSEGALVLLRCNYSSSVPPLFWYVQYPNQGLQLLLKYTSAEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSDLEPNSIIFGSGTRLSIR...................................................................................... 115
75 -41.700sp|P06889|LV405_HUMAN Ig lambda chain V-IV region MOL OS=Homo sapiens PE=1 SV=1  ali follow..  25  2................ELTQPP-SVSVSPGQTATISCSGDKLGESYDWYQQSPGQSPLLVIYEGPXRFSGSNSGNTATLTISGTESMDEADYYCQAWNSS--SVLFGGGTKLTVLG..................................................................................... 106

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 4 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.