current user: public

If you have questions about the server, please let us know.

Query: sp|P56385|ATP5I_HUMAN ATP synthase subunit e, mitochondrial OS=Homo sapiens GN=ATP5I PE=1 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILKLast
1 -52.000sp|P56385|ATP5I_HUMAN ATP synthase subunit e, mitochondrial OS=Homo sapiens GN=ATP5I PE=1 SV=2  ali  100  1MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK 69
2 -9.400sp|Q8TBB6|S7A14_HUMAN Probable cationic amino acid transporter OS=Homo sapiens GN=SLC7A14 PE=2 SV=3  ali   10  196LMLKLSTITWIRFAVWCFVGLLIYYGIWNSTLEISAREEALHQSTYQRYDVDDPFSVEEGFSYATE... 263
3 -8.860sp|O43246|CTR4_HUMAN Cationic amino acid transporter 4 OS=Homo sapiens GN=SLC7A4 PE=2 SV=3  ali   109LMLKLSYLTWVRFSIWLLMGLAVYYGIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQA... 176
4 -8.610sp|P30825|CTR1_HUMAN High affinity cationic amino acid transporter 1 OS=Homo sapiens GN=SLC7A1 PE=1 SV=1  ali   127LMMQLDQGTWVRFAVWMLIGFIIYYGLWHSEEASLDADQARTPDGNLDQCK.................. 179
5 -8.340sp|P52569|CTR2_HUMAN Low affinity cationic amino acid transporter 2 OS=Homo sapiens GN=SLC7A2 PE=1 SV=2  ali   10  125LMVQLSADTWVRFSIWMAIGFLIYYGIRHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHP... 192
6 -8.270sp|Q8WY07|CTR3_HUMAN Cationic amino acid transporter 3 OS=Homo sapiens GN=SLC7A3 PE=1 SV=1  ali   108LMMQMTAGTWARFGVWMLIGFAIYYGIQHSLEEIKSNQPSRKSRAKTVDLDPGTLYVHS.......... 168
7 -8.220sp|Q8TBB6|S7A14_HUMAN Probable cationic amino acid transporter OS=Homo sapiens GN=SLC7A14 PE=2 SV=3  ali   10  46LMLKLSTITWIRFAVWCFVGL-FGYGIWNSTLEISAREEALHQSTYQRYDVDDPFSVEEGFSYATE... 113
8 -7.970sp|Q9Y6H6|KCNE3_HUMAN Potassium voltage-gated channel subfamily E member 3 OS=Homo sapiens GN=KCNE3 PE=1 SV=1  ali follow..  13  62.........LFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNR...................... 99
9 -7.650sp|P15382|KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 OS=Homo sapiens GN=KCNE1 PE=1 SV=1  ali follow..  14  48.........LMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLES..... 102
10 -7.350sp|Q8WUA4|TF3C2_HUMAN General transcription factor 3C polypeptide 2 OS=Homo sapiens GN=GTF3C2 PE=1 SV=2  ali   14  240....VRFSPNLDSYGW--LVSGGQSGLVRIHFVRGLASPLGHRMQLESRAHFNAMFQPSSPTRRPGF.. 300

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Godzik A. Surface map comparison: studying function diversity of homologous proteins. J Mol Biol. 2001 Jun 8;309(3):793-806.