current user: public

If you have questions about the server, please let us know.

Query: sp|P57730|CAR18_HUMAN Caspase recruitment domain-containing protein 18 OS=Homo sapiens GN=CARD18 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLHLast
1 -45.500sp|P57730|CAR18_HUMAN Caspase recruitment domain-containing protein 18 OS=Homo sapiens GN=CARD18 PE=1 SV=1  ali  100  1MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH 90
2 -39.400sp|Q5XLA6|CAR17_HUMAN Caspase recruitment domain-containing protein 17 OS=Homo sapiens GN=CARD17 PE=1 SV=1  ali follow..  54  1MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLS 90
3 -34.900sp|Q5EG05|CAR16_HUMAN Caspase recruitment domain-containing protein 16 OS=Homo sapiens GN=CARD16 PE=1 SV=1  ali follow..  55  1MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLS 90
4 -28.500sp|Q9BXL6|CAR14_HUMAN Caspase recruitment domain-containing protein 14 OS=Homo sapiens GN=CARD14 PE=1 SV=2  ali   17  20..WEMMESHRHRIVRCIC---PSRLTPYLRQAKVLCQLDEEEVLHSPTNSAMRAGHLLDLLKTRGKNGAIAFLESLKFHNPDVYTLV... 103
5 -28.000sp|Q9BWT7|CAR10_HUMAN Caspase recruitment domain-containing protein 10 OS=Homo sapiens GN=CARD10 PE=2 SV=2  ali   15  28..WERIEGVRHRLARALN---PAKLTPYLRQCRVIDEQDEEEVLSTYPCRVNRTGRLMDILRCRGKRGYEAFLEALEFYYPEHFTLL... 111
6 -27.200sp|Q9HC29|NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens GN=NOD2 PE=1 SV=1  ali   26  30.SQEAFQAQRSQLVELLVSGSFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPK... 118
7 -27.000sp|Q9BXL7|CAR11_HUMAN Caspase recruitment domain-containing protein 11 OS=Homo sapiens GN=CARD11 PE=1 SV=3  ali   19  23..WENVECNRHMLSRYIN---PAKLTPYLRQCKVIDEQDEDEVLNAPPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLV... 106
8 -26.800sp|Q9C000|NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens GN=NLRP1 PE=1 SV=1  ali   24  178.LLHFVDQYREQLIARVT--SVEVVLDKL-HGQVLSQEQYERVLAE-NTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEK 262
9 -25.800sp|Q9Y2G2|CARD8_HUMAN Caspase recruitment domain-containing protein 8 OS=Homo sapiens GN=CARD8 PE=1 SV=1  ali follow..  23  344.GAAFVKENHRQLQARMGD--LKGVLDDLQDNEVLTENEKELVEQE-KTRQSKNEALLSMVEKKGDLALDVLFRSISERDPYLVSYLRQQ 429
10 -24.400sp|Q8TDM6|DLG5_HUMAN Disks large homolog 5 OS=Homo sapiens GN=DLG5 PE=1 SV=4  ali   18  1MEPELLAQCQQSLAQAMTE--VEAVLGLLEAAGALSPGERRQLDEE--AGGAKAELLLKLLLAKERDHFQDLRAALEKTQPHLLPIL... 86
11 -23.000sp|Q9H257|CARD9_HUMAN Caspase recruitment domain-containing protein 9 OS=Homo sapiens GN=CARD9 PE=1 SV=2  ali follow..  21  11..WSVLEGFRVTLTSVID---PSRITPYLRQCKVLNPDDEEQVLSDPVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKV... 94
12 -22.700sp|P78560|CRADD_HUMAN Death domain-containing protein CRADD OS=Homo sapiens GN=CRADD PE=1 SV=1  ali follow..  22  1MEAQVLRSLRLELGAEVLVE--GLVLQYLYQEGILTENHIQEINAQ-TTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFP.......... 80
13 -22.200sp|Q9BX69|CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens GN=CARD6 PE=1 SV=2  ali   25  7.PSEIIERERKKLLEILQHD-PDSILDTLTSRRLISEEEYETLENV-TDLLKKSRKLLILVQKKGEATCQHFLKCLFSTFPQSAAIC... 90
14 -21.500sp|O60936|NOL3_HUMAN Nucleolar protein 3 OS=Homo sapiens GN=NOL3 PE=1 SV=1  ali follow..  18  8.PSETIDRERKRLVETLQAD-SGLLLDALLARGVLTGPEYEALDAL-PDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQ 94
15 -19.800sp|P49662|CASP4_HUMAN Caspase-4 OS=Homo sapiens GN=CASP4 PE=1 SV=1  ali follow..  24  1MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADSMQEKQRMAGQMLLQTFFNIDQISPNKK... 87
16 -19.700sp|P29466|CASP1_HUMAN Caspase-1 OS=Homo sapiens GN=CASP1 PE=1 SV=1  ali follow..  52  1MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTL... 87
17 -18.500sp|Q9NPP4|NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens GN=NLRC4 PE=1 SV=2  ali   27  2...NFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCE-KVEQDAARGIIHMILKKGSESCNLFLKSLKEWNYPLFQDL... 84
18 -18.100sp|O95999|BCL10_HUMAN B-cell lymphoma/leukemia 10 OS=Homo sapiens GN=BCL10 PE=1 SV=1  ali follow..  18  18..KDALENLRVYLCEKII---AERHFDHLRAKKILSREDTEEISCR-TSSRKRAGKLLDYL-QENPKGLDTLVESIRREQNFLIQKIT.. 100
19 -16.000sp|P55211|CASP9_HUMAN Caspase-9 OS=Homo sapiens GN=CASP9 PE=1 SV=3  ali follow..  21  1MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASF... 88
20 -15.900sp|Q9Y239|NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens GN=NOD1 PE=1 SV=1  ali   29  19.HIQLLKSNRELLVTHIRN--TQCLVDNLLKNDYFSAEDAEIVCAC-PTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLAD......... 95
21 -15.000sp|Q9BYX4|IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens GN=IFIH1 PE=1 SV=3  ali   19  115..LQLLNLLQPTLVDKLL---VRDVLDKCMEEELLTIEDRNRIAAANNGNESGVRELLKRI-VQKENWFSAFLNVLRQTGNELVQELT.. 198
22 -14.400sp|Q9ULZ3|ASC_HUMAN Apoptosis-associated speck-like protein containing a CARD OS=Homo sapiens GN=PYCARD PE=1 SV=2  ali follow..  21  132.........................LLDALYGKVLTDEQYQAVRAE-PTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS 195
23 -12.800sp|P42575|CASP2_HUMAN Caspase-2 OS=Homo sapiens GN=CASP2 PE=1 SV=2  ali follow..  18  32MHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAK-VGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDM... 117
24 -12.600sp|O43353|RIPK2_HUMAN Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens GN=RIPK2 PE=1 SV=2  ali follow..  25  436.AQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTK-PTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNK.......... 513
25 -12.500sp|Q96LW7|BINCA_HUMAN Bcl10-interacting CARD protein OS=Homo sapiens GN=C9orf89 PE=1 SV=1  ali follow..  13  8...DRLVQDTPFLTGRLSEQQVDRIILQLYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRL... 95
26 -11.600sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2  ali   23  6..RNCLLQHREALEKDIK---TSYIMDHMISDGFLTISEEEKVRNE-PTQQQRAAMLIKMILKKDNDSYVSFYNALLHE........... 78
27 -11.600sp|Q9HC29|NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens GN=NOD2 PE=1 SV=1  ali   27  1.......................NMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLE.. 65
28 -9.920sp|P51878|CASP5_HUMAN Caspase-5 OS=Homo sapiens GN=CASP5 PE=1 SV=3  ali follow..  18  59VKKDNHKKKTVKMLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSL-RKNRVAHQMFTQTLLNMDQKITSV.... 143

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.