current user: public

If you have questions about the server, please let us know.

Query: sp|P58418|CLRN1_HUMAN(removed signalp:1-27) Clarin-1 OS=Homo sapiens GN=CLRN1 PE=1 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst LGTPLWIKATVLCKTGALLVNASGQELDKFMGEMQYGLFHGEGVRQCGLGARPFRFSFFPDLLKAIPVSIHVNVILFSAILIVLTMVGTAFFMYNAFGKPFETLHGPLGLYLLSFISGSCGCLVMILFASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMYLast
1 -110.000sp|P58418|CLRN1_HUMAN(removed signalp:1-27) Clarin-1 OS=Homo sapiens GN=CLRN1 PE=1 SV=2  ali  100  1LGTPLWIKATVLCKTGALLVNASGQELDKFMGEMQYGLFHGEGVRQCGLGARPFRFSFFPDLLKAIPVSIHVNVILFSAILIVLTMVGTAFFMYNAFGKPFETLHGPLGLYLLSFISGSCGCLVMILFASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY 205
2 -95.200sp|A0PK11|CLRN2_HUMAN(removed signalp:1-36) Clarin-2 OS=Homo sapiens GN=CLRN2 PE=2 SV=1  ali follow..  35  1.........KILCQTGVDLVNATDRELVKFIGDIYYGLFRGCKVRQCGLGGRQSQFTIFPHLVKELNAGLHVMILLLLFLALALALVSMGFAILNMIQVPYRAVSGPGGICLWNVLAGGVVALAIASFVAAVKFHDLTERIANFQEKLFQFVVVEEQYEESFWICVASASAHAANLVVVAISQIPLPEIKTKIEEATVTAEDILY 196
3 -90.800sp|Q8NCR9|CLRN3_HUMAN(removed signalp:1-32) Clarin-3 OS=Homo sapiens GN=CLRN3 PE=2 SV=1  ali follow..  22  1.....WITSTIAVRDSA----------SNGSIFITYGLFRGEEELSHGLAEPKKKFAVLEILNNSSQKTLHSVTILFLVLSLITSLLSSGFTFYNSISNPYQTFLGPTGVYTWNGLGASFVFVTMILFVANTQSNQLSEELFQMLYPATTSKGTTHSYGYSFWLILLVILLNIVTVTIIIFYQKARYQRKQEQRKEYAPRDGILF 194
4 -21.200sp|Q9UBN1|CCG4_HUMAN(removed signalp:1-27) Voltage-dependent calcium channel gamma-4 subunit OS=Homo sapiens GN=CACNG4 PE=2 SV=1  ali follow..  12  1IGTDYWLYSSAHICNGTNLTMDDGPPPRRAR-LTHSGLWR--FRINHFPEDNDYDHDSSEYLLRIVRAS-----SVFPILSTILLLLGGLCIGAGRIYSRKNNIVLSAGILF--VAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNH---------NYGWSFYFGALSIVAETVGVLAVNIYIEKNKELRFKTKRE......... 193
5 -20.600sp|Q06432|CCG1_HUMAN(removed signalp:1-23) Voltage-dependent calcium channel gamma-1 subunit OS=Homo sapiens GN=CACNG1 PE=2 SV=1  ali follow..  13  4VVTDHWAV-----------LSPHMEHHNTTCEAAHFGLWRLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIILGSLCVLLSLGKKRDYLLRPASMFYA---FAGLCILVSVEVMRQSVKRMIDSED----------TVWIEYYYSWSFACACAAFILLFLGGLALLLFSLPRMPRNP.............. 188
6 -20.300sp|B3SHH9|TM114_HUMAN(removed signalp:1-26) Transmembrane protein 114 OS=Homo sapiens GN=TMEM114 PE=2 SV=2  ali follow..  1IGTDFWYIIDTERLERTGPGAQDLLGSINRSQSSHSGLWRTCRVQSPCTPLMNPFRLENVTVSESSRQLLTMTFVILLPLSLILMVFGGMTGFLSFLLQAYLLLLLTGILFL---FGAMVTLAGISVYIA--YSAAAFREALCLLEEKALLDQVDISFGWSLALGWISFIAELLTGAAFLAAARELSLRRRQDQ........... 195
7 -20.100sp|O60359|CCG3_HUMAN(removed signalp:1-27) Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens GN=CACNG3 PE=2 SV=1  ali follow..  12  1VGTDYWLYSR---VCRTKSTSDNETSRKNEEVMTHSGLWR-LEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVSVFPILSVTLLFFGGLCVAASEFHRSRHNVILSAGIFF--VSAGLSNIIGIIVYISANAGDPGQR-----------DSKKSYSYGWSFYFGAFSIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLK...... 190
8 -19.300sp|Q9Y698|CCG2_HUMAN(removed signalp:1-27) Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens GN=CACNG2 PE=2 SV=1  ali follow..  12  1VGTDYWLYSR---VCKTKSVSENETSKKNEEVMTHSGLWR--KQIDHFPEDADYEADTAEYFLRAVRAS-----SIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFF--VSAGLSNIIGIIVYISANAGDPSKS-----------SKKNSYSYGWSFYFGALSIIAEMVGVLAVHMFIDRHKQLRATA............ 185
9 -19.300sp|Q9UF02|CCG5_HUMAN(removed signalp:1-29) Voltage-dependent calcium channel gamma-5 subunit OS=Homo sapiens GN=CACNG5 PE=2 SV=2  ali follow..  11  1..TDYWLYLE-------EGVIVPQNQSTEIKMSLHSGLWRGEERGRC----FTIEYVMPMNTQLTSESTVNVSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFF--ILSGLSLVVGLVLYISSINDEM-------LNRTKDAETYFNYKYGWSFAFAAISLLTESAGVMSVYLFMKRYTAEDMYRPHPG........ 186
10 -19.300sp|P62955|CCG7_HUMAN(removed signalp:1-20) Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens GN=CACNG7 PE=1 SV=1  ali follow..  8VSTDYWLYME-------EGTVLPQNQTTEVKMALHAGLWR-FFAGREKGRCVASEYFLEPEINLVTENTENITATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFF--ILSGLSLVVGLVLYISSINDEVMNR-------PSSSEQYFHYRYGWSFAFAASSLLKEGAGVMSVYLFTKRYAEEEMYRPHPA........ 195
11 -18.400sp|Q01453|PMP22_HUMAN(removed signalp:1-26) Peripheral myelin protein 22 OS=Homo sapiens GN=PMP22 PE=1 SV=1  ali follow..  15  1....QWIVGN----------------------GHATDLWQNCSTSSSGNVHHCFSSSPNEWLQ---------SVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIF--QILAGLCVMSAAAIYTVRHPEWHLNS---------------DYSYGFAYILAWVAFPLALLSGVIYVILRKR.................... 133
12 -17.700sp|Q8WXS5|CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens GN=CACNG8 PE=2 SV=3  ali follow..  12  39ISTDYWLYTRALICNTTNLTAGGDDEKKDPGGLTHSGLWR--VKINHFPEDTDYDHDSAEYLLRVVRAS-----SIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILF--VAAGLSNIIGVIVYISANAGEPGPKRDEEKKNH---------SYGWSFYFGGLSILAEVIGVLAVNIYIERSREAHCQSRSD......... 241
13 -17.000sp|Q6ZUX7|LHPL2_HUMAN(removed signalp:1-31) Lipoma HMGIC fusion partner-like 2 protein OS=Homo sapiens GN=LHFPL2 PE=2 SV=2  ali follow..  11  1....DWLIGKARSRGGVEPAGPGGGSPEPYHP--TLGIYA-IRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIKSIFNVCGLL--QGIAGLFLILGLILYPAGWGCQKAIDYCGHYASA---YKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLL 197
14 -16.200sp|P54849|EMP1_HUMAN(removed signalp:1-25) Epithelial membrane protein 1 OS=Homo sapiens GN=EMP1 PE=2 SV=3  ali follow..  15  1...NVWLVSN--------------------TVDASVGLWKNCTNISC------------SDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGAT--TLVCWLCILVGVSIYTSHYANRDGTQY----------------HHGYSYILGWICFCFSFIIGVLYLVLRKK.................... 132
15 -16.100sp|Q8NBL3|TM178_HUMAN(removed signalp:1-25) Transmembrane protein 178 OS=Homo sapiens GN=TMEM178 PE=2 SV=1  ali follow..  11  1IFTDHWYETDPRRHKESCERSRAGADPPDQK-ATYSGLWRKCYFLGIDIRLRNIPFNLTKTIQQDEWHLLHLITAGFLGMAVAVLLCGCIVATVSFFWEESLTQHVAGLLFL---MTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEH----GYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV.... 272
16 -15.900sp|Q86WI0|LHPL1_HUMAN(removed signalp:1-20) Lipoma HMGIC fusion partner-like 1 protein OS=Homo sapiens GN=LHFPL1 PE=2 SV=1  ali follow..  7YFLPYWLFGSQMGKPV------------------SFSTFRRCNYPVRGEGHSLIMVEECGRYASFIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELRMMGRCMGAA--QFVGGLLISSGCALYPLGWNSPEIMQTCGNVSNQ---FQLGTCRLGWAYYCAGGGAAAAMLICTWLSCFAGRNPKPVILVESIMRNTN--SY 190
17 -15.900sp|Q8TAF8|TMHS_HUMAN(removed signalp:1-42) Tetraspan membrane protein of hair cell stereocilia OS=Homo sapiens GN=LHFPL5 PE=1 SV=1  ali follow..  2FIQPYWIGDSV-----------------NTPQAGYFGLFS--YCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVLGMFLIIGSIICFSLFFICNTATVYKICA-----WMQLAAATGLMIGCLVYPDGWDSSEVRRMCGEQTGK---YTLGHCTIRWAFMLAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGTEEV... 177
18 -14.300sp|Q6ICI0|TM211_HUMAN(removed signalp:1-18) Transmembrane protein 211 OS=Homo sapiens GN=TMEM211 PE=2 SV=2  ali follow..  3LISPAWFQTPT----------------------FSFGILT-SWPQGNSWNQSCVTFSSLEDI----PDFAWKVSAVMLLGGWLLLAFNAIFLLSWAVAPKGRRSSVPMPGV--QAVAATAMIVGLLIFPIGLASPFIKEVCEASSM----YYGGKCRLGWGYMTAILNAVLASL-LPIISWPHTTKVQGRTIIFSSATERIIFV. 177
19 -14.200sp|Q9BXT2|CCG6_HUMAN Voltage-dependent calcium channel gamma-6 subunit OS=Homo sapiens GN=CACNG6 PE=2 SV=1  ali follow..  57VGTEFWVE-----------LNTYKANGSAVCEAAHLGLWK--GEANCTYFKFFTTGENARIFQRTTKKEVNLAAAVIAVLGLAVMALGCLCIIM-VLSKGAEFLLRVGAVC--FGLSGLLLLVSLEVFR---------HSVRALLQRVSPEPPPAPRLTYEYCGVGAGLILLLGAGCFLLLTLPSWPWGSLCPKRGHRA...... 259
20 -14.000sp|P54852|EMP3_HUMAN(removed signalp:1-29) Epithelial membrane protein 3 OS=Homo sapiens GN=EMP3 PE=2 SV=1  ali follow..  11  3..............................PGKESLNLWYDCTWNNDTKTWACSNVSENGWLK---------AVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLC--QLCTSVAVFTGALIYAIHAEEILEK-------------HPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKR.................... 133
21 -14.000sp|Q16617|NKG7_HUMAN(removed signalp:1-24) Protein NKG7 OS=Homo sapiens GN=NKG7 PE=1 SV=1  ali follow..  19  1..TDFWFEAV------------------GPTHSAHSGLWP--------------------TGHGDIISGYIHVTQTFSIMAVLWALVSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQPPHP-------------QIQTFFSWSFYLGWVSAILLLCTGALSLGAHCGGPRP................ 136
22 -13.700sp|Q9Y693|LHFP_HUMAN(removed signalp:1-21) Lipoma HMGIC fusion partner OS=Homo sapiens GN=LHFP PE=2 SV=1  ali follow..  6FFMPYWLWGS------------------QLGKPVSFGTFRRCSYPVHDESRQMMVMVE--ASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLRTVGRVAGGI--QFLGGLLIGAGCALYPLGWDSEEVRQTCGYTSGQ---FDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYP.............. 178
23 -13.600sp|P55344|LMIP_HUMAN(removed signalp:1-24) Lens fiber membrane intrinsic protein OS=Homo sapiens GN=LIM2 PE=1 SV=2  ali follow..  12  1..TDHWMQYR------------------LSGSFAHQGLWRYCLGNKC--------------YLQTDSIAYWNATRAFMILSALCAISGIIMGIMAFAHQPFSRISRPFSAGIMFFSSTLFVVLALAIYTGVTVSFLGR-------------RFGDWRFSWSYILGWVAVLMTFFAGIFYMCAYRVHECRRLSTPR.......... 149
24 -13.300sp|Q7Z7J7|LHPL4_HUMAN Lipoma HMGIC fusion partner-like 4 protein OS=Homo sapiens GN=LHFPL4 PE=2 SV=1  ali follow..  10  41FIQPYWVGDSV-----------------STPKPGYFGLFH---VGSGLAGRELTCRGSFTDFSTIPSSAFKAAAFFVLSMVLILGCITCFSLFFFCNTATVYKICA-----WMQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGK---YSLGDCSVRWAYILAIIGILNALILSFLAFVLGNRQTDLLQEELKPENKDFV... 217
25 -13.000sp|Q96B33|CLD23_HUMAN(removed signalp:1-19) Claudin-23 OS=Homo sapiens GN=CLDN23 PE=1 SV=2  ali follow..  12  6TLAPGWRLVKGFLNQPVDVE-------------LYQGLWDMCREQSSR----ERECGQTDQWGYFEAQPVLVARALMV-TSLAATVLGLLLASLGVQDEPNFVLAGLSGVVL--FVAGLLGLIPVSWYN---------HFLGDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALSFAPWCDERCRRRRKGPSAG.... 180
26 -12.100sp|Q86UP9|LHPL3_HUMAN Lipoma HMGIC fusion partner-like 3 protein OS=Homo sapiens GN=LHFPL3 PE=2 SV=2  ali follow..  10  41FIQPYWIGDGV-----------------DTPQAGYFGLFH--YCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFILSMMLIIACIICFTLFFFCNTATVYKICA-----WMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDK---YTLGACSVRWAYILAIIGILDALILSFLAFVLGNRQDSLMAEELKAENKVLL... 216
27 -12.100sp|O75204|TM127_HUMAN Transmembrane protein 127 OS=Homo sapiens GN=TMEM127 PE=1 SV=1  ali follow..  48LAEPAWLHIH-----------------GGTCSRQELGVSD--------VLGYVHPDLLKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQQHKKYHG-------SQVYVTFAVSFYLVAGAGGASILATAANLLRHYPTEEEEQAL............ 208
28 -11.500sp|P57739|CLD2_HUMAN(removed signalp:1-24) Claudin-2 OS=Homo sapiens GN=CLDN2 PE=1 SV=1  ali follow..  10  1MLLPSW------------KTSSYVGASIVTAVGFSKGLWMECATHSTGI---STLLGLPADIQ--AAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFF--ILGGLLGFIPVAWNL---------HGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFS....................... 160
29 -11.500sp|P54851|EMP2_HUMAN(removed signalp:1-16) Epithelial membrane protein 2 OS=Homo sapiens GN=EMP2 PE=2 SV=1  ali follow..  12  47........................................................................AVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSII--QLMSCLCVMIAASIYTDRRED-------IHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKR.................... 150
30 -10.900sp|Q6ZP80|TM182_HUMAN Transmembrane protein 182 OS=Homo sapiens GN=TMEM182 PE=2 SV=2  ali follow..  18  25FGSDYWLLAT-------EVGRCSGEKNIENVTFHHEGFFPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFWAVLMLLGVVAVVIASFLIICAAPFASHFLYKAGGGSYI---AAGILFSLVVMLYVIWVQAVADMESYRNMKMKDCLDFTPSVLYGWSFFLAPAGIFFSLLAGLLFLVVGWHIQ.................. 226
31 -10.800sp|P78369|CLD10_HUMAN(removed signalp:1-24) Claudin-10 OS=Homo sapiens GN=CLDN10 PE=1 SV=2  ali follow..  10  1LPTDYWKVSTIDGTVITTAT-------------YWANLWKACVTDSTGV---PSMLALDGYIQ--ACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVF--ILSGLCSMTGCSLYANKITTEFFDPLFVEQKY----------ELGAALFIGWAGASLCIIGGVIFCFS....................... 158
32 -10.600sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2  ali   2....................................................................AFYQSLICFFIPYLAYKGSDIDVFTFGTPINTISLTTILLHQAMWTIFHGVVLLGSFLMYFL-VSLLYNATCVICNSPTNPYWVMEGQLSNPTFYLFLTPVVALLPRYFFLSLQGTCGKSLISKAQKID........ 135
33 -10.400sp|Q96Q45|AL2S4_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein OS=Homo sapiens GN=ALS2CR4 PE=1 SV=1  ali follow..  13  229.......SMDVKPSWTTRDVALTVHRAFRMIGLFSHGFLAG--------------------------CAVWNIVVIYVLAGDQLSNLSNLLQQYKTLAYPFQSL-----LYLLLALSTISAFLASFLYFTALILSLSQQMTTPSSVNGSLWEAGIEEQILQPWVNLVVALLVGLSWLFLSYR....................... 403
34 -10.300sp|Q9NY35|CLDN1_HUMAN(removed signalp:1-24) Claudin domain-containing protein 1 OS=Homo sapiens GN=CLDND1 PE=1 SV=1  ali follow..  12  3IGTDFWYEYRSPVQENSSDLNKSNDALFRYNGTV--GLWPPERTESFDVVTKCVSFTLTEQFIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACI----RSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDN----------SGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKA.......... 225
35 -10.300sp|O95500|CLD14_HUMAN(removed signalp:1-21) Claudin-14 OS=Homo sapiens GN=CLDN14 PE=1 SV=1  ali follow..  12  4TILPHW------------RRTAHVGTNILTAVSYLKGLWMECVWHSTGI---RSLLALPQDLQ--AARALMVISCLLSGIACACAVIGMKCTRCAKGTPAKTTFAILGGTLF--ILAGLLCMVAVSWTT---------NDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLS....................... 163
36 -10.300sp|O00501|CLD5_HUMAN Claudin-5 OS=Homo sapiens GN=CLDN5 PE=1 SV=1  ali follow..  13  13LCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGH--KVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLY--LFCGLLALVPLCWFA---------NIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCG....................... 184
37 -10.200sp|P56880|CLD20_HUMAN(removed signalp:1-23) Claudin-20 OS=Homo sapiens GN=CLDN20 PE=2 SV=1  ali follow..  13  2TLLPNW------------KVNVDVDSNIITAIVQLHGLWMDCTWYSTGM---HSILSLPIHVQ--AARATMVLACVLSALGICTSTVGMKCTRLGGDRETKSHASFAGGVCF--MSAGISSLISTVWYT---------KEIIANFLDLTVPESNKHEPGGAIYIGFISAMLLFISGMIFCTS....................... 161
38 -10.200sp|P56747|CLD6_HUMAN(removed signalp:1-21) Claudin-6 OS=Homo sapiens GN=CLDN6 PE=1 SV=2  ali follow..  16  4CALPMW------------KVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQ---DSLLALPQDLQ--AARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVF--VISGVLTLIPVCWTA---------HAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCT....................... 163
39 -10.200sp|P56856|CLD18_HUMAN(removed signalp:1-24) Claudin-18 OS=Homo sapiens GN=CLDN18 PE=1 SV=1  ali follow..  11  2.GMDMWSTQDL-------------YDNPVTSVFQYEGLWRSCVRQSSGF---FTILGLPAMLQ--AVRALMIVGIVLGAIGLLVSIFAL-IRIGSMEDSAKANMTLTSGIMF--IVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTTFGAALFVGWVAGGLTLIGGVMMCIA....................... 171
40 -9.740sp|P56748|CLD8_HUMAN(removed signalp:1-23) Claudin-8 OS=Homo sapiens GN=CLDN8 PE=2 SV=1  ali follow..  13  2TVMPQW------------RVSAFIENNIVVFENFWEGLWMNCVRQANIR---DSLLALSPDLQ--AARGLMCAASVMSFLAFMMAILGM-TRCTGDNEKVKAHILLTAGIIF--IITGMVVLIPVSWVA---------NAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGALFCCV....................... 162
41 -9.490sp|O95484|CLD9_HUMAN Claudin-9 OS=Homo sapiens GN=CLDN9 PE=1 SV=1  ali follow..  13  13LAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQ--KVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVIL--LLAGILVLIPVCWTA---------HAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCT....................... 184
42 -9.380sp|Q8N6F1|CLD19_HUMAN(removed signalp:1-24) Claudin-19 OS=Homo sapiens GN=CLDN19 PE=1 SV=2  ali follow..  11  2.ALPQW------------KQSSYAGDAIITAVGLYEGLWMSCASQSTGQ--KLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGM-TRVGDSNPIAKGRVAIAGGALF--ILAGLCTLTAVSWYA---------TLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCT....................... 161
43 -9.330sp|O15551|CLD3_HUMAN Claudin-3 OS=Homo sapiens GN=CLDN3 PE=1 SV=1  ali follow..  14  12LAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ--KVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLF--LLAALLTLVPVSWSA---------NTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCS....................... 183
44 -9.310sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3  ali   11  3....................................................................AFYQSLVCFFVPYFTYQGSDTDIFAFGNPLNTAALFIVLLHLVILTWIHLLVIIGSILSYFL--FAIVFGAMCVTCNPPSNPYWIMQEHML-VFYLILTTSIALLPRFVYRVLQGSLFPSPILRAKHFD........ 136
45 -9.310sp|P56746|CLD15_HUMAN(removed signalp:1-25) Claudin-15 OS=Homo sapiens GN=CLDN15 PE=1 SV=1  ali follow..  13  1..NSYWRVSTVHGNVITTNT-------------IFENLWFSCATDSLGV---PSMLALSGYIQ--ACRALMITAILLGFLGLLLGIAGL-TNIGGLELSRKAKLAATAGALH--ILAGICGMVAISWYAFNITRDFFDPLYPGTKY----------ELGPALYLGWSASLISILGGLCLCSA....................... 157
46 -9.220sp|C9JDP6|CLD25_HUMAN(removed signalp:1-25) Putative claudin-25 OS=Homo sapiens GN=CLDN25 PE=5 SV=1  ali follow..  14  3TILPQWKTL---------------NLELNEMETWIMGIWEVCVDREEVA---ESFLSLPQELQ--VARILMVASHGLGLLGLLLCSFGSECFQFHRIRWVFKRRLGLLG--TLEASASATTLLPVSWVAHATIQDFWDDSIPD--------IIPRWEFGGALYLGWAAGIFLALGGLLLIFS....................... 161
47 -9.210sp|P56750|CLD17_HUMAN(removed signalp:1-23) Claudin-17 OS=Homo sapiens GN=CLDN17 PE=2 SV=1  ali follow..  13  2TLLPQW------------RVSAFVGSNIIVFERLWEGLWMNCIRQARVR---SSLLALPPALE--TARALMCVAVALSLIALLIGICGM-VQCTGSNERAKAYLLGTSGVLF--ILTGIFVLIPVSWTA---------NIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGGLLCGF....................... 162
48 -9.120sp|O95471|CLD7_HUMAN(removed signalp:1-24) Claudin-7 OS=Homo sapiens GN=CLDN7 PE=1 SV=4  ali follow..  2.AIPQW------------QMSSYAGDNIITAQAMYKGLWMDCVTQSTGMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGM-TRCGGDDKVKKARIAMGGGIIF--IVAGLAALVACSWYG---------HQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSGNESKAGYRVPRSYPKSNSSKEY 186
49 -9.110sp|Q96A59|MALD3_HUMAN MARVEL domain-containing protein 3 OS=Homo sapiens GN=MARVELD3 PE=2 SV=3  ali follow..  13  194LCTGRACCQMLEVLLNLLILACSSVSYSSTGGYTGITSLGGIYYYQFGGAYSGFDGADGEKAQQLDVQFYQLMVTVAMACSGALTALCCLFVAMGVLRVPWHCPLLLVTEGLLDMLIAGGYIPALYFYFHYLSAAYGSPVC--KERQALYQSKGYSGFGCSF-FAALGIVVFALGAVLAIKGYRKVRKLKEKPAEMFE....... 400
50 -9.090sp|Q9Y5I7|CLD16_HUMAN Claudin-16 OS=Homo sapiens GN=CLDN16 PE=1 SV=1  ali follow..  12  94TWTDCWMVNA---------------DDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLVTRALMITADILAGFGFLTLLLGL-VKFLPDEPYIKVRICFVAGATL--LIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQY------KFGWSCWLGMAGSLGCFLAGAVLTCC....................... 256

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.