current user: public

If you have questions about the server, please let us know.

Query: sp|P59091|CU093_HUMAN Uncharacterized protein C21orf93 OS=Homo sapiens GN=C21orf93 PE=5 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MDSLTERCRPQPLAALGPADAQLHGPAAAGGGVGPRVMLSSLCREHPWQGRCPPIPAHGKEVRQLRHLHRTRPPDTHQDMARGPGLPHTHGLPARPSHVRHQTEPVQVASRWHVPSDGLCRPCHVHQLLHPPLVPALGALast
1 -114.000sp|P59091|CU093_HUMAN Uncharacterized protein C21orf93 OS=Homo sapiens GN=C21orf93 PE=5 SV=1  ali  100  1MDSLTERCRPQPLAALGPADAQLHGPAAAGGGVGPRVMLSSLCREHPWQGRCPPIPAHGKEVRQLRHLHRTRPPDTHQDMARGPGLPHTHGLPARPSHVRHQTEPVQVASRWHVPSDGLCRPCHVHQLLHPPLVPALGA 139
2 -7.060sp|Q9UHC6|CNTP2_HUMAN(removed signalp:1-27) Contactin-associated protein-like 2 OS=Homo sapiens GN=CNTNAP2 PE=1 SV=1  ali   17  169.....NPGQGQAIR------NGVNRNSAIIGGVIAVVIFTILCT-----------------VFLIRYMFRHK--TYHTNEAKGAESAESADAAIMNNDPNFTETIDESKKEWLI......................... 254
3 -6.910sp|Q6PUV4|CPLX2_HUMAN Complexin-2 OS=Homo sapiens GN=CPLX2 PE=1 SV=2  ali follow..  10  1MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRP----KKAIPAGCGDEEEEEEESILDPGPLQDMF.......... 132
4 -6.260sp|Q6UY14|ATL4_HUMAN(removed signalp:1-24) ADAMTS-like protein 4 OS=Homo sapiens GN=ADAMTSL4 PE=1 SV=2  ali   17  1....TQSCQLRLCGHWEVGSPWSQCSVRCGRGQRSRQVRREACDMGPWSSKCSAECGTGIQRRSVVCLGSGAALGPGQGEAGAGTGQSCPTGSRPPDMRACSLGPCERTWRWYTGPWGECSEC................ 152
5 -6.240sp|Q07020|RL18_HUMAN 60S ribosomal protein L18 OS=Homo sapiens GN=RPL18 PE=1 SV=2  ali follow..  24  89.DVRVQEVPKLKVCALRVTSRARSRILRAGGKI---LTFDQLALDSP----------KGCGTVLLSGPRKGREVYRHFGKA--PGTPHSHTKPYVRSKGRK...................................... 173
6 -6.170sp|Q6UXR6|YI004_HUMAN(removed signalp:1-29) Putative uncharacterized protein UNQ6494/PRO21346 OS=Homo sapiens GN=UNQ6494/PRO21346 PE=5 SV=1  ali follow..  24  41........QPRCCRRATPVCCAGQGPPRSLQQGGSEVLLGQLCSPEP-------LPSSGPKVAKLQHPEHFVPSSVPEGCVHKPGSTCDGSLKGRPEHSREESHPLS................................ 153
7 -6.130sp|Q6UY14|ATL4_HUMAN(removed signalp:1-24) ADAMTS-like protein 4 OS=Homo sapiens GN=ADAMTSL4 PE=1 SV=2  ali   16  149..NITQSCQLRLCGHWEVGSPWSQCSVRCGRGQRSRQVRREACDMGPWSSKCSAECGTGIQRRSVVCLGSGAALGPGQGEAGAGTGQSCPTGSRPPDMRACSLGPCERTWRWYTGPWGEC................... 298
8 -6.120sp|Q9UGR2|Z3H7B_HUMAN Zinc finger CCCH domain-containing protein 7B OS=Homo sapiens GN=ZC3H7B PE=1 SV=1  ali   13  181........................................DVCR-HEVRYGCL---AHSFIELKVWLLQQYSGMTHEDIVQESKKYWQQMEAHAGKASSSMGAPRTHGPSTFDLQMKFVCGQC................ 266
9 -6.090sp|Q96DT7|ZBT10_HUMAN Zinc finger and BTB domain-containing protein 10 OS=Homo sapiens GN=ZBTB10 PE=1 SV=2  ali   18  2..SFSEMNR-RTLAFRGGGLVTASGGGSTNNNAGGEASAWPPQPQPRQPPPPAP-PPNGRGADEEVELEGLEPQDLEASAGPAAGLPQDAGGPTSLGG-GAGGPLLAERNRRTLAFRG..................... 127
10 -6.070sp|Q52M58|CN177_HUMAN Putative uncharacterized protein C14orf177 OS=Homo sapiens GN=C14orf177 PE=2 SV=1  ali follow..  23  23.................................GTKPMITRPSVSQLGEGKCP-------SSQHLQSLRHNKQHALTLTKARCCGECSTCFCTEEKSECQRHEET----------SPGSCN----HQIMSASTISAFCA 107

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.