current user: public

If you have questions about the server, please let us know.

Query: sp|P61960|UFM1_HUMAN Ubiquitin-fold modifier 1 OS=Homo sapiens GN=UFM1 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSCLast
1 -72.000sp|P61960|UFM1_HUMAN Ubiquitin-fold modifier 1 OS=Homo sapiens GN=UFM1 PE=1 SV=1  ali  100  1MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC 85
2 -11.300sp|P55854|SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens GN=SUMO3 PE=1 SV=2  ali follow..  15  15.DHINLKVAGQDGSVVQFK---IKRHTPLSKLMKAYCERQGLSMRQIRFR--DGQPINETDTPAQLEMEDEDTIDVFQQQTGGV. 93
3 -11.200sp|P63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 OS=Homo sapiens GN=SUMO1 PE=1 SV=1  ali follow..  12  20.EYIKLKVIGQDSSEIHFK---VKMTTHLKKLKESYCQRQGVPMNSLRFL--EGQRIADNHTPKELGMEEEDVIEVYQEQTGGHS 99
4 -11.100sp|Q6EEV6|SUMO4_HUMAN Small ubiquitin-related modifier 4 OS=Homo sapiens GN=SUMO4 PE=1 SV=2  ali follow..  11  16.NHINLKVAGQDGSVVQFK---IKRQTPLSKLMKAYCEPRGLSMKQIRFR--GGQPISGTDKPAQLEMEDEDTIDVFQQPTGGV. 94
5 -11.000sp|P61956|SUMO2_HUMAN Small ubiquitin-related modifier 2 OS=Homo sapiens GN=SUMO2 PE=1 SV=1  ali follow..  15  16.DHINLKVAGQDGSVVQFK---IKRHTPLSKLMKAYCERQGLSMRQIRFR--DGQPINETDTPAQLEMEDEDTIDVFQQQTGGV. 94
6 -8.640sp|O94817|ATG12_HUMAN Ubiquitin-like protein ATG12 OS=Homo sapiens GN=ATG12 PE=1 SV=1  ali follow..  19  53.KKIDILLKAVGDPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIVNQSFAPSPDQEVGTLYECFGSDGKLV........ 130
7 -7.370sp|Q8WTU0|DDI1_HUMAN Protein DDI1 homolog 1 OS=Homo sapiens GN=DDI1 PE=2 SV=1  ali follow..  18  2..LITVYCVRRDLSEVTFS-LQVSPDFELRNFKVLCEAESRVPVEEIQIIHMERLLIEDHCSLGSYGLKDGDIVVLLQKDNVGP. 82
8 -7.240sp|P11441|UBL4A_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens GN=UBL4A PE=1 SV=1  ali follow..  17  15....................LQVPEDELVSTLKQLVSEKLNVPVRQQRLLFK-GKALADGKRLSDYSIGPNSKLNLVVK...... 72
9 -7.030sp|Q8NCF5|NF2IP_HUMAN NFATC2-interacting protein OS=Homo sapiens GN=NFATC2IP PE=1 SV=1  ali follow..  344.TSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFF--DGTKLSGRELPADLGMESGDLIEVW........ 418
10 -7.030sp|Q12967|GNDS_HUMAN Ral guanine nucleotide dissociation stimulator OS=Homo sapiens GN=RALGDS PE=1 SV=2  ali   15  51....IIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEILSDDRKLKIPENANVFYAMNSTANYDFVLKKR.... 133

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.