current user: public

If you have questions about the server, please let us know.

Query: sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst ASALTQPRSLSGSPGQAVTISCTGLPSVVDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGNYIFVFGQGTDLTVLGLast
1 -80.800sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali  100  1ASALTQPRSLSGSPGQAVTISCTGLPSVVDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGNYIFVFGQGTDLTVLG 111
2 -78.000sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  68  1QSALTQPRSVSGSPGQSVTISCAGTSSDVGGNHFVSWYQQHPGKAPKLIIYGVNKRPSGVPYRFSGSKSGNTASLTISGLQAEDEAHYYCCSYAGRFTWVFGGGTNLTVLG 111
3 -77.200sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  68  1QSALTQPRSVSGSPGQSVTISCTGTSSDVGAYNSVSWYQQHPGKAPKLMIFDVTKRPSGVPDRLSGSKSGDTASLTISGLRADDEADYYCCSYAGRYSVIFGGGTKLTVLG 111
4 -77.100sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  62  1HSALTQPASVSGSLGQSITISCTGTSSDVGGYNYVSWFQQHPGTAPKLIISEVRNRPSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYTSSNSVVFGGGTKLTVLG 111
5 -77.000sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  65  1QSALTQPPRVSGSPGQSVTISCTGSYSNVTGYNHVSWYQQDPGKVPKLMIYDVDKRPSGVPDRFSGSKSANTASLTISGLQANNEADYYCSSYGGTYSLIFGGGTKLTVLG 111
6 -76.900sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  63  1QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLG 111
7 -76.300sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  67  1QSALTQPASVSGSPGQSITISCTGTTSDVGSYNFVSWYQQNPGKAPKLMIYEGNKRPSGVSNRFSGSKSGKTASLTISGLQVEDEADYYCCSYAGNSTRVFGGGTRVTVLS 111
8 -75.400sp|P01710|LV207_HUMAN Ig lambda chain V-II region BO OS=Homo sapiens PE=1 SV=1  ali follow..  69  1QSALTQPPSASGSPGQSVTISCTGTSSDVGDNKYVSWYQQHPGRAPKLVIFEVSQRPSGVPDRFSGSKSDNTASLTVSGLRAEDEADYYCSSYVDNNNFVFGGGTKLTVL. 110
9 -75.200sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  60  1QSALTQPASVSASPGQSITISCTGTTNDIGSYSYVSWYQQYPGKAPKVLIFDVNSRPSGVSHRFSGSKSGNTASLTISGLQAEDEAHYFCSSYRTSGTIIFGGGTYVTVL. 110
10 -73.500sp|P01708|LV205_HUMAN Ig lambda chain V-II region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  67  1QSALTQPRSVSGSPGHSVTISCIGTSSNVGDYKYVSWYQQHPGKAPKLIIYEVSSRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYIGS--YVFGTGTKVIVLG 109
11 -73.100sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  64  1QSALTQPASVSGSPGQSITISCTGTTSDVGGYDFVSWYQQHPGKAPKLLIYDVNSRPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTTSRAVFGGGTKLSVLG 112
12 -72.600sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  60  1QSVLTQPPSVSGTPGQRVTISCSGGSSNGTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRSAVVFGGGTQLTVL. 111
13 -72.100sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  66  1QSALTQPRSVSGSPGQSLTISCSGAPCDVDGCESVSWYQQHPGKAPKLIIYGFSNRPSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADSSV-IFGAGTKLTVL. 109
14 -72.100sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  56  1QSVLTQPPSASGTPGGRVTISCSGSSSNVGSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSDGYVFGTGTKVTVL. 111
15 -71.900sp|P01702|LV104_HUMAN Ig lambda chain V-I region NIG-64 OS=Homo sapiens PE=1 SV=1  ali follow..  60  1QSVLTQPPSVSAAPGQEVTISCSGSSS-NIGDNFVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSSVGMFGGGTRVTVLG 111
16 -71.300sp|P01714|LV301_HUMAN Ig lambda chain V-III region SH OS=Homo sapiens PE=1 SV=1  ali follow..  50  1.SELTQDPAVSVALGQTVRITCQGDS---LRGYDAAWYQQKPGQAPLLVIYGRNNRPSGIPDRFSGSSSGHTASLTITGAQAEDEADYYCNSRDSSKHVLFGGGTKLTVLG 108
17 -71.100sp|P06316|LV107_HUMAN(removed signalp:1-19) Ig lambda chain V-I region BL2 OS=Homo sapiens PE=2 SV=1  ali follow..  59  1QSVLTQPPSVSAAPGQKVTISCSGSSS-NIGNDYVSWYQQVPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWNNSSGWVFGGGTKLTVLG 111
18 -71.100sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  54  1QSVLTQPPSVSAAPGQKVTISCSGGST-NIGNNYVSWHQHLPGTAPKLLIYEDNKRPSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSNAVVFGGGTKVTVLG 111
19 -70.900sp|P01699|LV101_HUMAN Ig lambda chain V-I region VOR OS=Homo sapiens PE=1 SV=1  ali follow..  58  1QSVLTQPPSASGTPGQRVTISCSGG-NFDIGRNSVNWYQVHPGTAPRLLIYSSDQRSSGVPDRFSGSKSGTSASLAISGLQSENEADYFCATWDDSDGPVFGGGTKVTVLG 111
20 -70.800sp|P06319|LV605_HUMAN(removed signalp:1-19) Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1  ali follow..  56  3..MLTQPHSVSESPGKTVTISCTGN-SGSIASNYVQWYQQRRVSAPTIVIYEDNQRPLGVPDRFSGSISSNSASLTISGLKTEDEADYYCQSFDNTNQGVFGGGTKLTVLG 112
21 -70.800sp|P01721|LV601_HUMAN Ig lambda chain V-VI region AR OS=Homo sapiens PE=1 SV=1  ali follow..  60  3..MLTQPHSVSESPGKTVTFSCTGS-GGSIADSFVQWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSISANSASLTISGLKTEDEADYYCQSYNSNHHVVFGGGTKVTVLG 112
22 -70.500sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  56  1QSVLTQPPSLSAAPGQRVSISCSGSSS-NIGKNYVDWYQQLPGTAPKLLIFNNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNRRS-VFGGGTNVTVVG 109
23 -70.500sp|P01720|LV701_HUMAN Ig lambda chain V-VII region MOT OS=Homo sapiens PE=1 SV=1  ali follow..  51  3FYELTQPPSVSLAAGQTAMITCEGND---IGERSVHWYQQKPGQAPVPVIYDDADRPSGVPARFSGYNSGNSAILTINRVEAGDEADYFCQSWDNGYEVVFGTGTMVTVLG 111
24 -69.400sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  59  1QSVLTQPPSASGTPGQRVTISCFGS-SSNIGRYYVYWYQQLPGTTPKLLIYKDNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLW-VFGGGTTLTVLS 109
25 -68.800sp|P01722|LV602_HUMAN Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1  ali follow..  57  3..MLIQPPSVSESPGKTVTMSCTRT-SDSIASNYVQWYRQRPGGAPTTLIYDTNQRPYGVPNRFSGSFSSNSASLTISGLTNDDTAMYFCQSYDSSNLWVFGGGTKLTVLS 112
26 -68.700sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  51  1SYELTQPPSVSVSPGQTARITCSANAL---PNQYAYWYQQKPGRAPVMVIYKDTQRPSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNSAS-IFGGGTKLTVLG 107
27 -68.500sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  49  2..VLSQPPSVSVAPGQTARITCGGDG---IGGKSVHWYQQKPGQAPVLVVHEDNDRPAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRAHVVFGGGTKLTVLG 108
28 -68.200sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  55  2..ALTQPPSVSVSPGQTAVITCSGDNL---EKTFVSWFQQRPGQSPLLVIYHTSERPSEIPERFSGSSSGATATLTISGAQSVDEADYFCQTWDTITA-IFGGGTKLTVLS 106
29 -67.600sp|P06318|LV604_HUMAN Ig lambda chain V-VI region WLT OS=Homo sapiens PE=1 SV=1  ali follow..  57  3..MLTQPLSVSGSPEKTVTISCTGS-SGSIGSNYVQWYQQRPGSAPTNVIYENNQRPSEVPDRFSGSISSNSASLTISGLKTEDEADYYCQSYDNNN-HVVFGGTRLTVLG 111
30 -67.400sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  47  2VQMTQSPSSLSASVGDRVIITCRASQS---SVDYLNWYQQKPGKAPKLLIFDTSNLQSGVPSRFSGGRSGTDFTLTISSLQPDDFATYYCQQSYTNPEVTFGGGTTVDIK. 108
31 -67.300sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  46  2IVMTQSPATLSVSPGERATLSCRASQS---VSNNLAWYQQKPGQPPRLLIYGASTRATGIPARFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNWPPWTFGQGTRVEIK. 108
32 -67.200sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  57  3..MLTQPHSVSESPGKTVIISCTRS-DGTIAGYYVQWYQQRPGRAPTTVIFEDTQRPSGVPDRFSGSISSNSASLTISGLQTEDEADYYCQSYDRDH-WVFGGGTKLTVLG 111
33 -67.100sp|P01715|LV401_HUMAN Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1  ali follow..  57  2..GLTQPPSLSVSPGQTASITCSGDKL---GEQYVCWYQQKPGQSPVLVIYHDSKRPSGIPERFSGSNSGTTATLTISGTQAMDEADYYCQAWDSYTV-IFGGGTKLTVLG 106
34 -66.500sp|P04211|LV001_HUMAN(removed signalp:1-20) Ig lambda chain V region 4A OS=Homo sapiens PE=4 SV=1  ali follow..  48  3..VVTQEPSLTVSPGGTVTLTCASSTGAVTSGYYPNWFQQKPGQAPRALIYSTSNKHSWTPARFSGSLLGGKAALTLSGVQPEDEAEYYCLLYYGGA.............. 97
35 -66.400sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  54  2..DLTQPPSVSVSPGQTASITCSGDKL---GDKDVCWYQQRPGQSPVLVIYQDNQRSSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSMSV-VFGGGTRLTVL. 105
36 -66.400sp|P06889|LV405_HUMAN Ig lambda chain V-IV region MOL OS=Homo sapiens PE=1 SV=1  ali follow..  53  2..ELTQPPSVSVSPGQTATISCSGDKL---GESYYDWYQQSPGQSPLLVIYEGDKRPSGIPXRFSGSNSGNTATLTISGTESMDEADYYCQAWNSSSV-LFGGGTKLTVLG 106
37 -65.900sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  49  2..VLTQPPSVSVAPGETARLTCGGND---IGSESVHWYQQKPGQAPVLVIYFDRDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQLWDSSEHVVFGGGTKLTVLS 108
38 -65.100sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  47  2IVLTXSPGTLSLSPGXRAALSCRASQSL--SGNYLAWYQQKPGQAPRLLMYGVSSRATGIPDRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSSP-FTFGQGSKLEIK. 108
39 -65.000sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  45  2IVMTQSPDSLAVSLGERATINCKSSQSVSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP--TFGGGTKVEIK. 112
40 -65.000sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  50  2IQMTQSPSSLSASVGDRVTITCRASQS---ISNYLNWYQQKPGKAPKLLIYAASSLQSGVTSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYSTLI-TFGQGTRLEIK. 107
41 -64.700sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  46  3..VMTQSPTLSVSPGERATLSCRASQSI--SNSYLAWYQQKPSGSPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWP-PTFGQGTRVEIK. 108
42 -64.700sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  50  3..VMTQPDSLAVSLGERATINCKSSQSVSNSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPY-SFGQGTKLEIK. 113
43 -64.600sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  50  3..VLTQSPTLSLSPGERATLSCRASQSV--SSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTSP-RTFGQGTKVEIK. 108
44 -64.500sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  48  3.QMTQSPSSLSASVGDRVTITCRAGHN---ITNFLSWYQQKPGKAPTLLIYAVSNLQVGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNFSF-TFGGGTKVDNK. 107
45 -64.400sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  40  2IVLTQSPLSLPVTPGEPASISCRSSQNLXSXGXYLDWYLXKPGXSPXLLIYLGSNRASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQTPL-TFGGGTNVEIK. 111
46 -64.400sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  47  3.XMTQSPSSLSASVGDRVTITCRAGQS---VNKYLNWYQQKPGKAPKVLIFAASSLKSGVPSRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTTPY-TFGPGTKVEMT. 107
47 -64.200sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  50  3.QMTQSPSTLSASVGDRVTITCRASQS---INTWLAWYQQKPGKAPKLLMYKASSLESGVPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSDSK-MFGQGTKVEVKG 108
48 -64.200sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  51  2IQMTXSPSSLSASVGXRVTITCRASXT---ISSYLXWYXXKPGKAPXLLIYAASXLHSGVPSRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSSPT-TFGXGTRLXIK. 107
49 -64.100sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  49  3.QLTQSPSSLSASVGDRVTITCRASQS---VYNYVAWFQQKPGKAPKSLIYDASTLQSGVPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSYPY-TFGQGTKVQIK. 107
50 -64.100sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  50  1EIVLTQSPTLSLSPGERATLSCRASQSV--SNSFLAWYQQKPGQAPRLLIYVASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP-STFGQGTKVELK. 108
51 -64.000sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  42  2IQMTQSPSSLSATVGDRVTLLCEASQSVESGNTFLAWYQQKPKKAPKLLIYDASNLETGVPSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLP-STFGVASKVESK. 111
52 -64.000sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  42  2IVMTQSPLSLPVTPGEPASISCRSSQSHSDGFDYLNWYLQKPGQSPXLLIYALSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQAPI-TFGQGTRLEIK. 112
53 -64.000sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  50  3.QMTQSPSSLSASVGDRVTITCRASQS---ISSYLSWYQQKPGKAPQVLIYAASSLPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYITPT-SFGQGTRVEIK. 107
54 -64.000sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  46  2IQMTQSPSTLSASVGDRVAITCRASQN---ISSWLAWYQQKPGKAPKVLIYKSSSLESGVPSRFSGSGSGTDFTLTISSLXPXXFATYYCQQYNTF--FTFGPGTKVDIK. 106
55 -63.900sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  48  3.QMTQSPSSLSASVGDRVTITCQASQD---IRKHLNWYDQKPGKAPRLLIYGASTLETGVPSRFSGSGSGTDFTLTISTLQPEDIGNYYCQQYDNVPI-TFGQGTRVENKG 108
56 -63.900sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  49  3..VMTQPDSLAVSLGERATINCKSSQSISDNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNLPW-TFGQGTKVEIK. 113
57 -63.900sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  47  3.QMTQSPSSLSASVGDRVTITCQASQD---INHYLNWYQQGPKKAPKILIYDASNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPR-TFGQGTKLEIK. 107
58 -63.800sp|P01703|LV105_HUMAN Ig lambda chain V-I region NEWM OS=Homo sapiens PE=1 SV=1  ali follow..  58  1QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGNHVKWYQQLPGTAPKLLIFHNN-------ARFSVSKSGSSATLAITGLQAEDEADYYCQSYDRSLR-VFGGGTKLTVL. 102
59 -63.800sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  47  3.QMTQSPSPLSASVGDSVTITCQASQD---IRNSLIWYQQKPGKAPKFLIYDAENLEIGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNLPY-TFGQGTKLEIK. 107
60 -63.800sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  47  2IVLTQSPGTLSLSPGERATLSCRASQSV--SNSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSSP-QTFGQGSKVEIK. 108
61 -63.700sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  47  3.QMTQSPSSLSASVGDRVTITCQASQD---ISDYLNWYQQKPGKAPKLLIYDASNLESGVPSRFSGGGSGAHFTFTISSLQPEDIATYYCQQYDYLPW-TFGQGTKVEIK. 107
62 -63.700sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  49  3.QMTQSPSSLSASVGDRVTITCQASQD---IIKYLNWYQQTPGKAPKLLIYEASNLQAGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSLPY-TFGQGTKLQIT. 107
63 -63.700sp|P83593|KV405_HUMAN Ig kappa chain V-IV region STH (Fragment) OS=Homo sapiens PE=1 SV=1  ali follow..  49  3..VMTQPDSLVVSLGERATINCRSSQSVSNNKNYLAWYQQKPGQAPKLLFSWASTRESGVPDRFSGSGSGTDFTLTIPGLQAEDVAVYYCQQYYRIPY-TFGQGAK..... 109
64 -63.700sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  40  5DIVMTQSPSLPVTPGEPASISCRSSQSLSNGYNYLDWYLQKPQQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQTPQ-TFGQGTKVEIK. 116
65 -63.600sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  48  2IVLTQSPGTLSLSPGERATLSCRASQSV--SSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSSPW-TFGQGTKVEIK. 108
66 -63.500sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  48  3.QMTQSPSSLSASVGDRVTITCRASQG---IRNDLTWYQQKPGTAPKRLIYGATSLQSGVPSRFSGSGSGTEFTLTINSLQPEDFATYYCLQYSSFPW-TFGQGTKVEVK. 107
67 -63.500sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  44  2IVLTQSPGTLSLSPGERATLSCRAALLS--SRGYLAWYQQKPGQAPRLLMYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP-RSFGQGTKVEIK. 108
68 -63.500sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  41  2DIVMTQTPSLPVTPGEPASISCRSSQSSGDGNTYLNWYLQKAGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEIPY-TFGQGTKLEIR. 114
69 -63.400sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  40  2VVMTQSPLSLPVTLGQPASISCRSSQSYSDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWSW-TFGQGTKVEIK. 112
70 -63.400sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  47  3.QMTQSPSSLSASVGDRVTIICRASQG---IRNDLTWYQQKPGKAPKELIYAASNLQSGVPSRFSGSGAGTEFTLTISSLQPEDFATYYCLQQNSYPR-SFGQGTKVEIK. 107
71 -63.400sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  46  3.QMTQSPSTQPASVGDRVTITCRASQS---INIWLAWYQQKPEKAPKLLIYKASTLETGVPSRFSGSGSGTEFTLTINSLQPDDFATYYCQQYSRYPY-TFGQGTKLDIK. 107
72 -63.400sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  49  2IQMTQSPSSLSVSVGDRVTITCQASQN---VNAYLNWYQQKPGLAPKLLIYGASTREAGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYNNWPP-TFGQGTKVEVK. 107
73 -63.200sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  45  2IVLTQSPGTLSLSPGESATLSCRASQS---VSSNLAWYQQKRGQSPRLLIRDASSRANGIPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYSTSPY-TFGQGTKLEIK. 107
74 -63.200sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  38  2VVMTQSPLFLPVTLGEPASIQCRSSQSLVYGXTYLXWYLQKPGQSPELLIYLSSYRDSGVPDRFSDSGSGTDFTLKITRVQAEDVGVYYCMQATXSPY-TFGQGTKLXIK. 112
75 -63.100sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  46  2IQMTQSPSSLSASVGDRVTITCQASQD---ISIFLNWYQQKPGKAPKLLIYDASKLEAGVPSRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNLPL-TFGGGTKVDFK. 107

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 4 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.