current user: public

If you have questions about the server, please let us know.

Query: sp|Q12893|TM115_HUMAN(removed signalp:1-46) Transmembrane protein 115 OS=Homo sapiens GN=TMEM115 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# Score Template Links and tools%idFirst VTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTLLast
1 -119.000sp|Q12893|TM115_HUMAN(removed signalp:1-46) Transmembrane protein 115 OS=Homo sapiens GN=TMEM115 PE=1 SV=1  ali  100  1VTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL 305
2 -41.000sp|Q8TEB9|RHBD1_HUMAN Rhomboid domain-containing protein 1 OS=Homo sapiens GN=RHBDD1 PE=2 SV=1  ali follow..  12  59......CYQQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYLLLQFAVAEFMDEPDF-KRSCAVGFSGVLFALKVLNNHYCPGGFVNILGF-----VPNRFACWVELVAIHLFSPGTSFAGHLAGILVGLMYTQGPLKYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRR--------QRLHRFDSQ.................................................. 315
3 -37.000sp|Q9Y3P4|RHBD3_HUMAN(removed signalp:1-33) Rhomboid domain-containing protein 3 OS=Homo sapiens GN=RHBDD3 PE=2 SV=1  ali follow..  15  6LAPELLL-DPWQVHRLLTHALGHTALPGLLLSLLLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSA--------AGSCGYMPVHLAMLAGEGH----RPRRPRGALPPWLSPWLLLALTPLLS-----SEPPFLQLLCGLLAGLAYFRWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPYVASPDLWSHWEDSALPPPSLRPVQP-AALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRV 319
4 -35.900sp|Q6NTF9|RHBD2_HUMAN Rhomboid domain-containing protein 2 OS=Homo sapiens GN=RHBDD2 PE=2 SV=2  ali follow..  10  54......ALRNWQVYRLVTYIFVYENPISLLCGAIIIWRFAGNFERTVGTVRHCFFTVIFAIFSAIIFLSFEAVSSLSKLGEV----EDARGFTPVAFAMLGVTTVRSRMRRALVFMVVPSVLVPWLLLGASWLI------PQTSFLSNVCGLSIGLAYGLTYCYSIDLSERVALKLDQTFPFSLMRRISVFKYVSG--SSAERRAAQSRKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQKLASWPSCTPGHMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSP.. 339
5 -34.600sp|Q8NBM4|UBAC2_HUMAN Ubiquitin-associated domain-containing protein 2 OS=Homo sapiens GN=UBAC2 PE=2 SV=1  ali follow..  13  48......VKNDFQIWRLICGRIICLDLKDTFCSSLLIYNF-RIFERRYGSRKFASFLLGSWVLSALFDFLLIEAMQYFFGITA--ASNLPSGFLAPVFALFVPFYCSIPRQVAQILGPLSITNKTLIYILGLQLF----TSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPI------------------------------FSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQV 310
6 -30.400sp|Q9H300|PARL_HUMAN Presenilins-associated rhomboid-like protein, mitochondrial OS=Homo sapiens GN=PARL PE=1 SV=2  ali follow..  10  205...........LCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYG---------PSLGASGAIMTVLAAVCTKIPEGRIIFLPMFTFTAGNALKAIIAMTAGMILGWKFFDHAAHLGGALFGIWYVTYGHE............................................................................................................................................. 351
7 -28.700sp|Q6PJF5|RHDF2_HUMAN Rhomboid family member 2 OS=Homo sapiens GN=RHBDF2 PE=1 SV=2  ali   17  53...........QFYRLWLSLFLHAGVVHCLVSVVFQMTILRDLEKLAGWHRIAIIFILSGITGNLASAIFL--------------YRAEVGPAGSQFGLLACFVELFQSWPLLERPWKAFLNLSAIVLFLFICGLLPWIDNIAHIFGFLSGLLLAFAFLPYITFGTSDK........................................................................................................................................ 198
8 -27.000sp|Q96CC6|RHDF1_HUMAN Rhomboid family member 1 OS=Homo sapiens GN=RHBDF1 PE=1 SV=2  ali   16  52...........QFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFL--------------YRAEVGPAGSQFGILACFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHISGFISGLFLSFAFLPYISFGK........................................................................................................................................... 194
9 -26.300sp|Q9NX52|RHBL2_HUMAN Rhomboid-related protein 2 OS=Homo sapiens GN=RHBDL2 PE=1 SV=2  ali follow..  13  119...........EAWRFISYMLVHAGVQHILGNLCMQLVLGIPLEMVHKGLRVGLVYLAGVIAGSLASSIFD--------------LRYLVGASGGVYALMGGYFMNVLVNFQEMIPAFGIFRLLIIILIIVLDMGFAEDGSPVSFAAHIAGGFAGMSI................................................................................................................................................... 260
10 -25.700sp|P58872|RHBL3_HUMAN Rhomboid-related protein 3 OS=Homo sapiens GN=RHBDL3 PE=2 SV=1  ali follow..  14  210...........QVWRYLTYIFMHAGIEHLGLNVVLQLLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVAD--------------TAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAPPCPHPSFVAHLGGVAVGITL................................................................................................................................................... 353
11 -25.600sp|Q96CC6|RHDF1_HUMAN Rhomboid family member 1 OS=Homo sapiens GN=RHBDF1 PE=1 SV=2  ali   20  202...........QFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLASAIFL--------------YRAEVGPAGSQFGILACL.......................................................................................................................................................................................................... 280
12 -25.000sp|O75783|RHBL1_HUMAN Rhomboid-related protein 1 OS=Homo sapiens GN=RHBDL1 PE=2 SV=1  ali follow..  11  244...........RAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGLLRISLLYLAGVLAGSLTVSITD--------------RAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAASGPQPSFMAHLAGAVVGVSM................................................................................................................................................... 387
13 -24.700sp|Q6PJF5|RHDF2_HUMAN Rhomboid family member 2 OS=Homo sapiens GN=RHBDF2 PE=1 SV=2  ali   21  203...........QFYRLWLSLFLHAGVVHCLVSVVFQMTILRDLEKLAGWHRIAIIFILSGITGNLASAIFL--------------YRAEVGPAGSQFGLLACL.......................................................................................................................................................................................................... 281
14 -17.800sp|Q96Q80|DERL3_HUMAN Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2  ali follow..  12  42YFNPHLVFRKFQVWRLVTNFLFFGPLFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL-------------GQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLL-----GNSILVDLLGIAVGHIYYFLEDVFPNQPGGKR.................................................................................................................................... 197
15 -16.400sp|Q9GZP9|DERL2_HUMAN Derlin-2 OS=Homo sapiens GN=DERL2 PE=1 SV=1  ali follow..  12  42YFNPELIFKHFQIWRLITNFLFFGPVFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFL-------------GQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLL-----GNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIR.................................................................................................................................... 197
16 -15.900sp|Q9BUN8|DERL1_HUMAN Derlin-1 OS=Homo sapiens GN=DERL1 PE=1 SV=1  ali follow..  11  40FLWPEAFLYRFQIWRPITATFYFPVGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLL-------------MIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGG-----SVINELIGNLVGHLYFFLMFRYPMDLGGR--------------------------NFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ..................................................... 251
17 -13.200sp|Q5JSZ5|BA2L1_HUMAN Protein BAT2-like 1 OS=Homo sapiens GN=BAT2L1 PE=1 SV=2  ali   10  193...............................................................................................................................................................................................................KFIQSEMSEAVERARKRREEEERRAREERLAACALKQLDQKCKQARKAGEARKQAEKEVPWSPSAEKASPQENGPAVHKGSPEFPAQETPTTFPEEA. 291
18 -12.500sp|Q96L73|NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens GN=NSD1 PE=1 SV=1  ali   12  195...............................................................................................................................................................................................................GDMEKEPGIPSLTPQAELPEPAVRSEKKRLRKPSKWLLEKKKQKKVQEQVHKVSSRCEEESLLARGRSSAQNKQVDENSLISTKEEPPVLEREAP... 300
19 -12.300sp|Q2KJY2|KI26B_HUMAN Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=1 SV=1  ali   11  1........................................................................................................................................................................................................................GDSRPAEAGEAAAGKSERDCLKCNTFAELQERLDCIDGSEEPSSFPFEELPAQFGPEQASRGPRLSQAAGASPLSESDKEDNGSEGQL. 88
20 -11.900sp|Q8N687|DB125_HUMAN(removed signalp:1-20) Beta-defensin 125 OS=Homo sapiens GN=DEFB125 PE=2 SV=2  ali follow..  13  37.............................................................................................................................................................................................................ISIISHEYTRRPAFPVIHLEDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTH. 135
21 -11.800sp|P49069|CAMLG_HUMAN Calcium signal-modulating cyclophilin ligand OS=Homo sapiens GN=CAMLG PE=1 SV=1  ali follow..  14  1.............................................................................................................................................................................................................MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQ. 99
22 -11.700sp|Q5JSZ5|BA2L1_HUMAN Protein BAT2-like 1 OS=Homo sapiens GN=BAT2L1 PE=1 SV=2  ali   10  43...............................................................................................................................................................................................................KFIQSEMSEAVERARKRREEEERRAREERLAACALKQLDQKCKQARKAGEARKQAEKEVPWSPSAEKASPQENGPAVHKGSPEFPAQETPTTFPEEA. 141
23 -11.200sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 OS=Homo sapiens GN=SRRM2 PE=1 SV=2  ali   17  1................................................................................................................................................................................................................SSSSSSGSSSSDSEGSSLPVQPEVALKRREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQAL 109
24 -11.100sp|O95490|LPHN2_HUMAN(removed signalp:1-25) Latrophilin-2 OS=Homo sapiens GN=LPHN2 PE=1 SV=2  ali   11  2.............WMCLEGVQLYLMLVEVFESKKYYYVAG------YL-------ATVVGVSAAIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLSSRLENIKSWVLGAFALLCLLGLTWSFGLLFINEETIVMAYLFTIFNAFIFIFHCALQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRRMWNDTVRKQSESSFISGDINSTSTLNQGMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPVFNSPGHSLNNARDTSAMDTLP... 300
25 -11.100sp|P48634|BAT2_HUMAN Large proline-rich protein BAT2 OS=Homo sapiens GN=BAT2 PE=1 SV=3  ali   15  1...........................................................................................................................................................................................................................................QRRKQSSSEISLAVERARRRREEEERRMQEERRAACAEKLKRLDEKFGAPDKRLKAEPAAPPAAPSTPA. 69
26 -11.000sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1  ali   14  1.............................................................................................................................................................................................................................MSLPLTEEQRKKIEENRQKALARRAEKLLAEQHQRTSSGTSIAGNPFQAKQGPSQNFPRESCKPVSHGVIFKQQNLSSSSNAD. 83
27 -11.000sp|O95155|UBE4B_HUMAN Ubiquitin conjugation factor E4 B OS=Homo sapiens GN=UBE4B PE=1 SV=1  ali   15  2...................................................................................................................................................................................................................................EELSADEIRRRRLA------RLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNMTPATSPIGASGV. 72
28 -10.900sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4  ali   15  108....................................................................................................................................................................................................VRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRRAARMKSLEQ-LSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTSTSPGRLSPDFAEELRSL 226
29 -10.800sp|Q9Y2G9|SBNO2_HUMAN Protein strawberry notch homolog 2 OS=Homo sapiens GN=SBNO2 PE=2 SV=3  ali   1...........................................................................................................................................................................................................................................RKKQVGIKIVLQELRLMDADVKRRQAPALGCPAPPAPRPLALPCGPGEVLDLTYSPPAEAFPPPPHFSF. 76
30 -10.800sp|P31629|ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens GN=HIVEP2 PE=1 SV=2  ali   13  2....................................................................................................................................................................................................................DYGNLSHAPVSGAAASTVSPSRERKRQASFSGSPEISQGEVGMDQSVKQEQLEHLHAGLRSGWHHGPPAVLPPLQQEDPGKQVAGPCPPLSS. 98
31 -10.800sp|Q7Z591|AKNA_HUMAN AT-hook-containing transcription factor OS=Homo sapiens GN=AKNA PE=1 SV=2  ali   15  1.......................................................................................................................................................................................................................AAAPLPCGPTETIPSFLLTRAGRDQAICELQERLRLRLEDSLHQPLQGSPTRPASAFDRPARTRGRPADSPATWGSHYGSKSTERLPGE. 92
32 -10.700sp|Q8WVE7|T170A_HUMAN Transmembrane protein 170A OS=Homo sapiens GN=TMEM170A PE=2 SV=1  ali follow..  15  49.........GVFLWALVSSLFFHVPAGLLALFTLRHHKYGRFMS-------ILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFEALTLGTGQTFCVLVVSFLRILA..................................................................................................................................................................................................... 142
33 -10.600sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=2 SV=3  ali   2..........YDQWFITLFNIVYTSLPVLAMGIF-LYKPGQL-NLLFNKRKFFIC-VLHGIYTSLVLFFIPYGAFVAGEDGQHIADYQSFAVTMATSLVIVVSVQIALDTSYWTF----INHVFIWGSIAIYFSILFTMHSNGIFGIFPNQFPFVGNARHSLTQ--------------CIWLVILLTTVASVMPVVAFRFLKVDLYPTLSDQIRRWQKAQKKARPPSSRRPRTRRSSSRRSGYAFAHQEGYGELITSGKNMRAKNPPPTSGLEKTHYNSTSWIENLCKKTTDTVSSFSQDKTVKL 292
34 -10.500sp|Q5JTC6|F123B_HUMAN Protein FAM123B OS=Homo sapiens GN=FAM123B PE=1 SV=2  ali   1...............................................................................................................................................................................................................................TEKAVAEKFPSMPKPKKGLKGFFSSIRRHRKSKVTGAEQSEPGAKGPERVRARPHEHVSSAPQVPCFEETFQAPRKENANP. 81
35 -10.400sp|Q8IZQ8|MYCD_HUMAN Myocardin OS=Homo sapiens GN=MYOCD PE=1 SV=1  ali   11  3.....................................................................................................................................................................SQQQQQQQHRFSYLGMHQAQLKEPNEQMVRNPNSSSTPLSNTPLSPVKNSFSGQTGVSSFKPGPLPPNLDDLKVSELRQLMDRLRPFQDCSGNPVPNFGDITTVTFPVTPNTLPNYQSSSSTSALSNGFYHFGSTSSSP. 156
36 -10.400sp|B2RTY4|MYO9A_HUMAN Myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2  ali   11  47................................................................................................................................................................................................................QEDVLVRERPRSLEDLHQKKVGRAKRESRRMRELEQAIFSLELLKVRSLGGISPSEDRRWSTELVPEGLQSPRGTPDSESSQGSLELLSYEESQKS. 142
37 -10.300sp|Q09472|EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens GN=EP300 PE=1 SV=2  ali   7...............................................................................................................................................................................................................................LNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYL. 87
38 -10.200sp|Q0VD83|AB48R_HUMAN Apolipoprotein B-100 receptor OS=Homo sapiens GN=APOB48R PE=1 SV=1  ali   15  61...............................................................................................................................................................................................................EAMGSARGGAANSWSEAPLPGSLLDVSVPRSRVHLSRSSSQRRSRPSFRRTPAWEQQEEPPAPNPPEEELSAPEQRPLQLEEPLEPSPLRHDGTPVP. 157
39 -10.200sp|Q9ULL8|SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens GN=SHROOM4 PE=1 SV=3  ali   10  106...............................................................................................................................................................................................................GDSEPKECSRMGGRRSGGTRGRSIQNRRKSERFATNLRNEQLQKSKGPLSQLCDTKEPVEETQEPPESPPLTASNTSLLSSCKKPPSPRDKLFNKSM. 208
40 -10.100sp|P07197|NFM_HUMAN Neurofilament medium polypeptide OS=Homo sapiens GN=NEFM PE=1 SV=3  ali   71...............................................................................................................................................................................................................SGREEEKGVVTNGLDLSPADEKKGGDKSEEKVVVTKTVEKITSEGGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQSD.. 166
41 -10.100sp|O14776|TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens GN=TCERG1 PE=1 SV=2  ali   200............................................................................................................................................................................................................QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPT 300
42 -10.100sp|P49750|YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens GN=YLPM1 PE=1 SV=3  ali   13  178...............................................................................................................................................................................................................SHHSSEMMGSDASLDSDQGLGGVMVLSQRQHEIILKAAQE--EQKEQLQKMKDFGSEPQMADHLPPQESRLQNTSSRPGMYPPPGSYRPPPPMGKPP. 277
43 -9.980sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens GN=HNRNPUL2 PE=1 SV=1  ali   18  12......................................................................................................................................................................................................................................RSELQRRGSRGLKVLAQRLQEALDAEMLEDEAGGGGAGPGGACKAEPRPVAASGGGPGGDEEEDEEEEEEDEEA. 88
44 -9.970sp|O75459|GAGB1_HUMAN G antigen family B member 1 OS=Homo sapiens GN=PAGE1 PE=1 SV=2  ali follow..  52...............................................................................................................................................................................................................SAAQGQEPEADSQELVQPKTGCELGDGPDTKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPNPEEVKTPEEDEGQSQP... 146
45 -9.950sp|P55196|AFAD_HUMAN Afadin OS=Homo sapiens GN=MLLT4 PE=1 SV=3  ali   13  194...............................................................................................................................................................................................................................QSKPDRSAEESDRLRKLMLWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQLEEMRKREAE. 275
46 -9.940sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1  ali   202...............................................................................................................................................................................................................TAGTVSSTTEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTREQENEEKEKEEKEKQDKEKQEEKKESET. 298
47 -9.930sp|Q70CQ4|UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens GN=USP31 PE=1 SV=2  ali   10  12...............................................................................................................................................................................................................KSGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTALLSKKAGGSSVKSVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSA. 108
48 -9.910sp|Q8WWN8|ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ARAP3 PE=1 SV=1  ali   15  98...............................................................................................................................................................................................................PFLSKSSTLGQEERPPEPPPGPPSKSSPQARGSLEEQLLQELSSLILRKGETTAGLGSPSQPSSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSQPLT. 194
49 -9.890sp|O14598|VCY1_HUMAN Testis-specific basic protein Y 1 OS=Homo sapiens GN=VCY PE=2 SV=1  ali follow..  13  1.......................................................................................................................................................................................................MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLS. 105
50 -9.840sp|Q9UD71|PPR1B_HUMAN Protein phosphatase 1 regulatory subunit 1B OS=Homo sapiens GN=PPP1R1B PE=1 SV=2  ali follow..  108...............................................................................................................................................................................................................LGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT. 204
51 -9.820sp|Q9Y2J4|AMOL2_HUMAN Angiomotin-like protein 2 OS=Homo sapiens GN=AMOTL2 PE=1 SV=3  ali   11  6......................................................................................................................................................................................................................SPSSSFNEGLLTGGHRHQEMESRKDAVIKVLQQRSRRDPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAP. 105
52 -9.780sp|Q9BYP7|WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens GN=WNK3 PE=1 SV=2  ali   15  178......................................................................................................................................................................................................................QTPGLEPTTLQPTTVLESDGERPPKLEIKTLDEKLRNLLYQEHSISSIYPESQKDTQSIDSPFSSSAEDTLSCPVTEVIAISHCGIKDSPV 273
53 -9.770sp|Q5T1A1|DCST2_HUMAN DC-STAMP domain-containing protein 2 OS=Homo sapiens GN=DCST2 PE=2 SV=2  ali   11  75...............................................................................................................................................................................................................PEQAWLLQQQLQEVLGRSLSMESTSESSDLDEEKGPQQRKHGQQPLPEAHQPVSILTSPEPHRPPETSSATKGAPTPASEPSVPLSPPSLPDPSHPP. 171
54 -9.760sp|Q8WW38|FOG2_HUMAN Zinc finger protein ZFPM2 OS=Homo sapiens GN=ZFPM2 PE=1 SV=3  ali   10  1.........................................................................................................................................................................................................................................MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEVEYFCNKGDDE.. 70
55 -9.720sp|Q9NY74|ETAA1_HUMAN Ewing`s tumor-associated antigen 1 OS=Homo sapiens GN=ETAA1 PE=1 SV=2  ali   21  144.....................................................................................................................................................................................................................................SPEEIQRKRQEALVRRMAKARASSVNAAPTSF............................................ 175
56 -9.720sp|Q9C0D2|K1731_HUMAN Leucine-rich repeat-containing protein KIAA1731 OS=Homo sapiens GN=KIAA1731 PE=2 SV=4  ali   12  4.........................................................................................................................................................LEFAFEDMYNADRKVKGNLILHLE-----PEPLPTVTNQIQDEELDLSMEQENLGAAEDLPVTEAEICSSETDVPLVMKTQQIPSKVLFKKLLNKIRSQKSLWTIKSMSEDESEMITTVSEIESKAPTVESGTIASKERTLSSGQEQVVES. 149
57 -9.700sp|Q9UGU0|TCF20_HUMAN Transcription factor 20 OS=Homo sapiens GN=TCF20 PE=1 SV=3  ali   15  117...............................................................................................................................................................................................................SKDLPSPDSRNCPAVTLTSPAKTKILPPRKRGLKLEAIVQKITSPNIRRSASSNSAEAGGDTVTLDDILSLKSGPPEGGSVAVQDADIEKRKGEVAS. 214
58 -9.690sp|Q13029|PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens GN=PRDM2 PE=1 SV=3  ali   14  203...............................................................................................................................................................................................................ETDSDPMVPSCSLSLPLSISTTEAVSFHKEKSVYLSSKLKQLLQTQDKLTPAGISATEIAKLGPVCVSAPASMLPVTSSRFKRRTSSPPSSPQHSPAL 300
59 -9.680sp|Q684P5|RPGP2_HUMAN Rap1 GTPase-activating protein 2 OS=Homo sapiens GN=RAP1GAP2 PE=1 SV=2  ali   12  3.........................................................................................................................................................................................................................................EDRTRAALLDNLHDELHAHTQAMLGLGPEEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKKSHSGGI. 73
60 -9.680sp|Q9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens GN=SETD2 PE=1 SV=3  ali   13  1........................................................................................................................................................................................................................TPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTP. 92
61 -9.670sp|Q15424|SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4  ali   12  1...........................................................................................................................................................................................................MAETLSGLGDSGAAGAAALSSASSETGTRRLSDLRVIDLRALMERLKKAIEDEGGNPDEIEITSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDV. 116
62 -9.650sp|Q15878|CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens GN=CACNA1E PE=1 SV=3  ali   13  12....................................................................................................................................................................................................................................RSSHLRERRRRHHMSVWEQRTSQLRKHMQMSSQEALNREEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLA. 87
63 -9.650sp|O60423|AT8B3_HUMAN Probable phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4  ali   6...........................EQSLEKPELYVVGQK-DELFNYWVFVQA-IAHGVTTSLVNFFMTLWISRDTAGPASFSDHQSFAVVVALSCLLSITMEVILIIKYWTALCVATILLSLGFYAIMTT------------------TTQSFWLFRVSPTTFPFLYADLSVMSSPSIL---LVVLLSVSINTFPVLALRVIFPALKELRAKEEKVEEGPSEEIFTMEPLPHVHRESRARRSSYAFSHREGYANLITQGTILRRGPGVSSDIASESLDPSDEEAASSPKES........... 249
64 -9.590sp|Q70EL1|UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens GN=USP54 PE=1 SV=4  ali   57..............................................................................................................................................................................................SLHLEQKGDCAAALALCNEAISKLRLALHGASCST---HSRALVDKKLQISIRSLQDRMQQQQSPQQPSQPSACLPTQAGTLSQPTSEQPIPLQVLLSQEAQLESGMDTEFGAS. 170
65 -9.580sp|Q7Z3B3|K1267_HUMAN MLL1/MLL complex subunit KIAA1267 OS=Homo sapiens GN=KIAA1267 PE=1 SV=1  ali   11  1...............................................................................................................................................................................................................SPDEENEEIEDLSDAAFAALHAKCEEMERAR---WLWTTSVPPQRRGSRSYRSSDGRTTPQLGSANPSTPQPASPDVSSSHSLSEYSHGQSPRSPIS. 94
66 -9.550sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3  ali   1........................................................................................................................................................................................................................................ETQMKKEIKLRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQQQHGQNPQQAHQH. 73
67 -9.530sp|Q6UX68|XKR5_HUMAN(removed signalp:1-53) XK-related protein 5 OS=Homo sapiens GN=XKR5 PE=2 SV=1  ali   2..HFWVFVVAGAHWLVMTFWLVAQQLFNLLVGAVYILCYLSFWDS--SRNRMVTFYMVMLLENIILLLLATDFLQGASWTSLQTIAGVLSGFLIGSVSLVIYYSLLHPKSTDIWQGCLRKSCGIAGGDKTERRDSPRATDLA--------------------GKRTESSGSCQGASYEPTILGKPPTPEQVPPEALWVKLALKTGNVSKINAAFGDNSPAYCPPAWGLSQQDYLQRKALSAQQELPSSSRDPSTLENSSAFEGVPKAEADPLETSSYVSFASDQQDEAPTQN............. 299
68 -9.530sp|Q9NNX9|VCX3_HUMAN Variable charge X-linked protein 3 OS=Homo sapiens GN=VCX3A PE=2 SV=1  ali follow..  89...............................................................................................................................................................................................................LPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSV 186
69 -9.490sp|Q8WTP9|GAGD4_HUMAN G antigen family D member 4 OS=Homo sapiens GN=XAGE3 PE=2 SV=1  ali follow..  1...........................................................................................................................................................................................................MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADLQELSQSKTGGECGNGPDDQGKILPKSEQFKM. 101
70 -9.490sp|Q13067|GAGE3_HUMAN G antigen 3 OS=Homo sapiens GN=GAGE3 PE=1 SV=1  ali follow..  1...........................................................................................................................................................................................................MNLSRGKSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPP. 101
71 -9.490sp|Q2KHR3|QSER1_HUMAN Glutamine and serine-rich protein 1 OS=Homo sapiens GN=QSER1 PE=1 SV=3  ali   98......................................................................................................................................................GFIASFLFLKSGPKQQAVRMPNRTRRPGTQMVRTFCPPPLPKPSSTTPTPLVSETGGNSPSDKVDNELKNLEHLSSFSSDEDDPGYSQDAPLTTLDATSDKKKKTEALQVATTSPTANTTGTATTSSTTVGAVKQEPLHSTSYAVNILENISSS. 262
72 -9.470sp|Q9H322|VCX2_HUMAN Variable charge X-linked protein 2 OS=Homo sapiens GN=VCX2 PE=2 SV=3  ali follow..  12  9...............................................................................................................................................................................................................GPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESAPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLS. 105
73 -9.470sp|Q96HA1|P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens GN=POM121 PE=1 SV=2  ali   20  106..........................................................................................................................................................................................KAVLSPRNSRMVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAP--KETVLSALKEKEKKRTVEEEDQIFLDGQENKRRRHDSSGSGHSAFEPLVANGVPAS----FVPKPGSL 222
74 -9.460sp|P18583|SON_HUMAN Protein SON OS=Homo sapiens GN=SON PE=1 SV=4  ali   10  199...............................................................................................................................................................................................................ADRSMMSSYSAADRSMMSSYTADRSMMSMAADSYTDSYTDTYTEAYMVPPLPPEEPPTMPPLPPEEPPMTPPLPPEEPPEGPALPTEQSALTAENTW. 295
75 -9.460sp|A6H8Y1|BDP1_HUMAN Transcription factor TFIIIB component B`` homolog OS=Homo sapiens GN=BDP1 PE=1 SV=3  ali   12  71...............................................................................................................................................................................................................SDKEERTDAAPKSQQMDSRTSSSKASLSRPGRRPLGFLSLICSKNSLESDEPMQVHSKKRLKPLIPGLRKKLKRSNPFNESQEKNRESSDLLPSPSV. 167

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.