current user: public

If you have questions about the server, please let us know.

Query: sp|Q14390|GGTL2_HUMAN Gamma-glutamyltransferase light chain 2 OS=Homo sapiens GN=GGTLC2 PE=2 SV=4, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPVDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSEILFNDEMDDFSSPNITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQPPSHADHTPMPQAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGYLast
1 -116.000sp|Q14390|GGTL2_HUMAN Gamma-glutamyltransferase light chain 2 OS=Homo sapiens GN=GGTLC2 PE=2 SV=4  ali  100  1MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPVDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSEILFNDEMDDFSSPNITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQPPSHADHTPMPQAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 218
2 -105.000sp|Q9BX51|GGTL1_HUMAN Gamma-glutamyltransferase light chain 1 OS=Homo sapiens GN=GGTLC1 PE=2 SV=2  ali follow..  88  1MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY 225
3 -104.000sp|B5MD39|GGTL3_HUMAN Putative gamma-glutamyltransferase light chain 3 OS=Homo sapiens GN=GGTLC3 PE=5 SV=1  ali follow..  86  1MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 225
4 -92.700sp|Q9UJ14|GGT7_HUMAN Gamma-glutamyltransferase 7 OS=Homo sapiens GN=GGT7 PE=1 SV=2  ali   27  1.............INDSQAAP-APLLPVYELDGAPTAAQVLIMGPDDFIVAMVSSLNQPFGSGLITP-SGILLNSQMLDFSWPNRTANHSA-PSLENSVQPGKRPLSFLLPTVVRPAEGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDLQSNLLQVDSEFTEEEIEFLEARGHHVEKVDV-LSWVHGSRRTNNFIIAVKDPRSPDAAGA. 209
5 -85.100sp|P19440|GGT1_HUMAN(removed signalp:1-30) Gamma-glutamyltranspeptidase 1 OS=Homo sapiens GN=GGT1 PE=1 SV=2  ali follow..  92  315MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 539
6 -85.000sp|P36268|GGT2_HUMAN(removed signalp:1-30) Gamma-glutamyltranspeptidase 2 OS=Homo sapiens GN=GGT2 PE=1 SV=3  ali follow..  85  315MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCLTIMVGQDGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAALDSRKGGEPAGY 539
7 -81.900sp|A6NGU5|GGT3_HUMAN(removed signalp:1-30) Putative gamma-glutamyltranspeptidase 3 OS=Homo sapiens GN=GGT3P PE=5 SV=2  ali follow..  87  315MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNMDDFSS-PSITNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 538
8 -81.500sp|P36269|GGT5_HUMAN(removed signalp:1-26) Gamma-glutamyltransferase 5 OS=Homo sapiens GN=GGT5 PE=1 SV=2  ali follow..  35  326LLGETLAQLIRQQIDGRGDHQLSHYSLAEAWGHGTGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGIILNNELLDLCSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAGGAGGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNS-KGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY 560
9 -63.400sp|Q9UJ14|GGT7_HUMAN Gamma-glutamyltransferase 7 OS=Homo sapiens GN=GGT7 PE=1 SV=2  ali   30  138MLSKVEAAYLRGHINDSQAAPAPLLPV-YELDGAPTAAQVLIMGPDDFIVAMVSSLNQPFGSGLITP-SGILLNSQMLDFSWPNRTANHS-APSLENSVQPGKRPLSFLLPTVVRPAEGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDL............................................................. 300
10 -40.100sp|Q6P531|GGT6_HUMAN Gamma-glutamyltransferase 6 OS=Homo sapiens GN=GGT6 PE=2 SV=2  ali follow..  12  320......LLALLEAALRSGAPIPDPCPPFLQTAVSPESSALAAVDSSGSVLLLTSSLNCSFGSAHLSPSTGVLLSNLVAKSTTS--------------------AWACPLILRGSLDDTVASGTPDVARAMTHTLLRHLAARPPTQAQHQHQGQQEPTEHPSTCGQGTLLQVAAHTEHAHVSSV---PHACCPFQGF...................... 493

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.