current user: public

If you have questions about the server, please let us know.

Query: sp|Q15116|PDCD1_HUMAN(removed signalp:1-24) Programmed cell death protein 1 OS=Homo sapiens GN=PDCD1 PE=2 SV=3, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPLLast
1 -106.000sp|Q15116|PDCD1_HUMAN(removed signalp:1-24) Programmed cell death protein 1 OS=Homo sapiens GN=PDCD1 PE=2 SV=3  ali  100  1LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL 264
2 -55.400sp|Q9H106|SIRPD_HUMAN(removed signalp:1-29) Signal-regulatory protein delta OS=Homo sapiens GN=SIRPD PE=2 SV=2  ali follow..  15  2.........HVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRK---LIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSA--LPERNSTNYFVQP................................................................................................... 153
3 -53.400sp|P04436|TVA1_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region HPB-MLT (Fragment) OS=Homo sapiens PE=2 SV=1  ali follow..  19  1........QKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALDSSAS--KIIFGSGTRLSIR............................................................................................................................................... 111
4 -53.100sp|P10966|CD8B_HUMAN(removed signalp:1-18) T-cell surface glycoprotein CD8 beta chain OS=Homo sapiens GN=CD8B PE=1 SV=1  ali follow..  12  1.......NSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFGTIHGEEVEQEKIAVF--RDASRFILNLTSVKPEDSGIYFCMIVGS---PELTFGKGTQLSVVDFLPTTAQPKRVCRLPRPETQKGPLCSPITLGL.............................................................................................................. 157
5 -52.600sp|P04437|TVA2_HUMAN(removed signalp:1-21) T-cell receptor alpha chain V region CTL-L17 OS=Homo sapiens GN=TCRA PE=2 SV=1  ali follow..  19  2...QKNDDQQVKQNSPSLSVQEGRISILNCDYTNSMFDY-FLWYKKYPAEGPTFLISI-SSIKDKNEDGRFTVFLNKSAKHLSLHIVPSQPGDSAVYFCAAKGAGTASKLTFGTGTRLQVT............................................................................................................................................... 117
6 -52.600sp|P01737|TVA3_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region PY14 OS=Homo sapiens PE=1 SV=1  ali follow..  20  1........QSVTQLGSHVSVSEGALVLLRCNYSS-SVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSDLEPNSSIIFGSGTRLSIR............................................................................................................................................... 115
7 -52.400sp|A6NJW9|CD8BL_HUMAN(removed signalp:1-18) Putative T-cell surface glycoprotein CD8 beta-2 chain OS=Homo sapiens GN=CD8BP PE=5 SV=2  ali follow..  12  1.......NSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMCIYWLRQRQAPSSDSHHEFGTIHGEEVEQEKIAVF--RDASRFILNLTSVKPEDSGIYFCMIVGS---PELTFGKGTQLSVVVDFLPTTAQKRVCRLPRPETQKGPLCS.................................................................................................................... 152
8 -52.200sp|P09564|CD7_HUMAN(removed signalp:1-25) T-cell antigen CD7 OS=Homo sapiens GN=CD7 PE=1 SV=1  ali follow..  13  1.......AQEVQQSPHCTTVPVGASVNITCSTSGG----LRGIYLRQLGPQPQDIIYYEDGVVPRRFRGRIDFS--GSQDNLTITMHRLQLSDTGTYTCQAITEVN----VYGSGTLVLVTEEQSQGWHRDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMS................................................... 201
9 -51.900sp|O95976|IGSF6_HUMAN(removed signalp:1-27) Immunoglobulin superfamily member 6 OS=Homo sapiens GN=IGSF6 PE=2 SV=2  ali follow..  15  2.......TLSVTQPWYLEVDYTHEAVTIKCTFSATSEQPTCLWFRYGAHQPENLCLDGCKSE-----ADKFTVREALKENQVSLTVNRVTSNDSAIYICGIASVPEARAKQTGGGTTLVVREIKLLSKELRLTALVSLLSVYVTGVCVAFILLSKSKSNPL----------RNKEIKEDSQKKKSARRIFQEIAQELYHKRHVETNQQSEKDNNTY--ENRRVLSNYERP.................................. 214
10 -49.400sp|P01732|CD8A_HUMAN(removed signalp:1-21) T-cell surface glycoprotein CD8 alpha chain OS=Homo sapiens GN=CD8A PE=1 SV=1  ali follow..  13  1........SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKDTQRFSGK--RLGDTFVLTLSDFRRENEGYYFCSALS---NSIMYFSHFVPVFLPAKPTTTPATPAPTIASQPLSLRPEACRPAA................................................................................................................. 147
11 -48.700sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  23  1.......EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLI-YGASSRATGIPDRFSGS--GSGTDFTLTISRLEPXDFAVYYCQQYG---SSPWTFGQGTKVEIK............................................................................................................................................... 108
12 -48.400sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  23  1...GSSGDIVMTQSPLSLPVTPGEPASISCRSSQSNGYNYLDWYLQKPQQSPQLLI-YLGSNRASGVPDRFSGS--GSGTDFTLKISRVEAEDVGVYYCMQGLQTP---QTFGQGTKVEIK............................................................................................................................................... 116
13 -48.400sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  22  1.......EIVLTQSPGTLSLSPGERATLSCRAALLSSRGYLAWYQQKPGQAPRLLM-YGASSRATGIPDRFSGS--GSGTDFTLTISRLEPEDFAVYYCQQYG---SSPRSFGQGTKVEIK............................................................................................................................................... 108
14 -48.400sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  24  1.......EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLI-YGASSRATGIPDRFSGS--GSGTDFTLTISRLEPEDFAVYYCQQYGTSPR---TFGQGTKVEIK............................................................................................................................................... 108
15 -48.400sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.......EIVLTQSPGTLSLSPGERATLSCRASQSVSNSFLAWYQQKPGQAPRLLI-YVASSRATGIPDRFSGS--GSGTDFTLTISRLEPEDFAVYYCQQYGSSPS---TFGQGTKVELK............................................................................................................................................... 108
16 -48.300sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.......EIVMTQSPVTLSVSPGERATLSCRASQSISNSYLAWYQQKPSGSPRLLI-YGASTRATGIPARFSGS--GSGTEFTLTISSLQSEDFAVYYCQQYNNWPP---TFGQGTRVEIK............................................................................................................................................... 108
17 -48.200sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.......EIVLTQSPGTLSLSPGERATLSCRASQSVSNSYLAWYQQKPGQAPRLLI-YGASSRATGIPDRFSGS--GSGTDFTLTISRLEPDDFAVYYCQQYGSSP---QTFGQGSKVEIK............................................................................................................................................... 108
18 -48.000sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  24  1.......XIVLTXSPGTLSLSPGXRAALSCRASQSLSGNYLAWYQQKPGQAPRLLM-YGVSSRATGIPDRFSGS--GSGADFTLTISRLXPEDFAVYYCQQYGSSP---FTFGQGSKLEIK............................................................................................................................................... 108
19 -47.900sp|P04435|TVB2_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region CTL-L17 OS=Homo sapiens GN=TCRB PE=2 SV=1  ali follow..  20  2..........VSQNPRHNITKRGQNVTFRCDPIS--EHNRLYWYRQTLGQGPEFLTYFQNEAKSRLLSDRFSAERP-KGSFSTLEIQRTEQGDSAMYLCASSLAGLNQPQHFGDGTRLSIL............................................................................................................................................... 112
20 -47.800sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.......EIVLTQSPGTLSLSPGERATLSCRASQSVSSGYLGWYQQKPGQAPRLLI-YGASSRATGIPDRFSGS--GSGTDFTLTISRLEPEDFAVYYCQQYGSLG---RTFGQGTKVEIK............................................................................................................................................... 108
21 -47.600sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  26  1.......DVQMTQSPSSLSASVGDRVIITCRASQSSVDY-LNWYQQKPGKAPKLLI-FDTSNLQSGVPSRFSGG--RSGTDFTLTISSLQPDDFATYYCQQSYTNP--EVTFGGGTTVDIK............................................................................................................................................... 108
22 -47.400sp|P40259|CD79B_HUMAN(removed signalp:1-28) B-cell antigen receptor complex-associated protein beta chain OS=Homo sapiens GN=CD79B PE=1 SV=1  ali follow..  12  8RNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGN--VSWLWKQEMDENPQQLKLEKG----------RMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTS-EVYQGCGTELRVMGFSTLAQLKNTLKDGIIMIQTLLIILFIIV---PIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE........................................................ 201
23 -47.400sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  25  1.......EIVLTQSPGTLSLSPGESATLSCRASQSVSSN-LAWYQQKRGQSPRLLI-RDASSRANGIPDRFSGS--GSGTDFTLIISRLEPEDFAVYYCQQYSTSP---YTFGQGTKLEIK............................................................................................................................................... 107
24 -47.300sp|P03979|TVC_HUMAN(removed signalp:1-17) T-cell receptor gamma chain V region PT-gamma-1/2 OS=Homo sapiens GN=TRGV3 PE=2 SV=1  ali follow..  17  2.......SSNLEGRTKSVTRQTGSSAEITCDLTV-TNTFYIHWYLHQEGKAPQRLLYYDVSTARSGLSPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRXKNYKKLFGSGTTLVVT............................................................................................................................................... 119
25 -47.200sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  23  1.......DIVMTQSPDSLAVSLGERATINCKSSQSVSKNYLAWYQQKPGQPPKLLI-YWASTRESGVPDRFSGS--GSGTDFTLTISSLQAEDVAVYYCQQYYSTP---YSFGQGTKLEIK............................................................................................................................................... 113
26 -47.100sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  27  1.......DIQMTQSPSSLSASVGDRVTITCQASQDI-SIFLNWYQQKPGKAPKLLI-YDASKLEAGVPSRFSGT--GSGTDFTFTISSLQPEDIATYYCQQFDNLP---LTFGGGTKVDFK............................................................................................................................................... 107
27 -47.100sp|Q96BF3|TMIG2_HUMAN(removed signalp:1-22) Transmembrane and immunoglobulin domain-containing protein 2 OS=Homo sapiens GN=TMIGD2 PE=1 SV=2  ali follow..  13  2.........SVQQGPNLLQVRQGSQATLVCQVDQATERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLS---WQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGFLVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGAPKKSEDCSGEGKDQRGQSIYSTSFPQPAPR----QPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFP. 255
28 -47.100sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.......DIQMTQSPSSLSASVGDRVTITCRASQDITNY-VNWFQQRPGQAPKVLI-YGASILETGVPSRFSGS--GSGTDFTFTISSLQPEDIATYYCQQYDTLP---LTFGGGTKVDIK............................................................................................................................................... 107
29 -47.000sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  25  1.......DVVMTQSPLFLPVTLGEPASIQCRSSQSLGXTYLXWYLQKPGQSPELLI-YLSSYRDSGVPDRFSDS--GSGTDFTLKITRVQAEDVGVYYCMQATXSP---YTFGQGTKLXIKR.............................................................................................................................................. 113
30 -47.000sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  25  1.......EIVMTQSPATLSVSPGERATLSCRASQSV-SNNLAWYQQKPGQPPRLLI-YGASTRATGIPARFSGS--GSGTEFTLTISRLQSEDFAVYYCQQYNNWPPW--TFGQGTRVEIK............................................................................................................................................... 108
31 -47.000sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  28  1.......DIQMTQSPSSLSASVGDRVTITCRASQSISNY-LNWYQQKPGKAPKLLI-YAASSLQSGVTSRFSGS--GSGTDFTLTISSLQPEDSATYYCQQSYS---TLITFGQGTRLEIK............................................................................................................................................... 107
32 -47.000sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  27  1.......DIVMTQSPLSLPVTPGEPASISCRSSQSDGFDYLNWYLQKPGQSPXLLI-YALSNRASGVPDRFSGS--GSGTDFTLKISRVEAEDVGVYYCMXALQ---APITFGQGTRLEIKR.............................................................................................................................................. 113
33 -46.900sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  23  1.......DVVMTQSPLSLPVTLGQPASISCRSSQSLGNTYLNWFQQRPGQSPRRLI-YKVSNRDSGVPDRFSGS--GSGTDFTLKISRVEAEDVGVYYCMQGTH---WSWTFGQGTKVEIKR.............................................................................................................................................. 113
34 -46.900sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.......DIQMTQSPSTLSASVGDRVAITCRASQNISSW-LAWYQQKPGKAPKVLI-YKSSSLESGVPSRFSGS--GSGTDFTLTISSLXPXXFATYYCQQYNTF----FTFGPGTKVDIK............................................................................................................................................... 106
35 -46.900sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  27  1.......DIQMTQSPSTLSVSVGDRVTITCEASQTVLSY-LNWYQQKPGKAPKLLI-YAASSLETGVPSRFSGQ--GSGTXFTFTISSVXPXXFATYYCQXYLDLP---RTFGQGTKVDLK............................................................................................................................................... 107
36 -46.900sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  25  1.......DIQMTQSPSSLSASVGDRVTITCRASQSISSY-LSWYQQKPGKAPQVLI-YAASSLPSGVPSRFSGS--GSGTDFTLTISSLQPEDFATYYCQQNYITP---TSFGQGTRVEIK............................................................................................................................................... 107
37 -46.800sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  26  1.......DIQMTQSPSPLSASVGDSVTITCQASQDI-RNSLIWYQQKPGKAPKFLI-YDAENLEIGVPSRFRGS--GSGTDFALSISSLQPEDFATYYCQQYYN---LPYTFGQGTKLEIK............................................................................................................................................... 107
38 -46.800sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  22  1.......DIVMTQSPDSLAVSLGERATINCKSSQSINKNYLAWYQQKPGQPPKLLI-YWASTRESGVPDRFSGS--GSGTDFTLTISSLQAEDVAVYYCQQYYNLP---WTFGQGTKVEIK............................................................................................................................................... 113
39 -46.800sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.......DIQMTQSPSSLSASVGDRVTIICRASQGI-RNDLTWYQQKPGKAPKELI-YAASNLQSGVPSRFSGS--GAGTEFTLTISSLQPEDFATYYCLQQNSYP---RSFGQGTKVEIK............................................................................................................................................... 107
40 -46.800sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  25  1.......DIVLTQSPLSLPVTPGEPASISCRSSQXSXGXYLDWYLXKPGXSPXLLI-YLGSNRASGVPNRFSGS--GSGTXFTLKISRVXAXXVGVYYCMQALQTP---LTFGGGTNVEIKR.............................................................................................................................................. 112
41 -46.800sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  27  1.......DIQMTQSPSSLSVSVGDRVTITCQASQNV-NAYLNWYQQKPGLAPKLLI-YGASTREAGVPSRFSGS--GSGTDFTFTISSLQPEDIATYYCQQYNNWP---PTFGQGTKVEVK............................................................................................................................................... 107
42 -46.700sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  27  1.......DIQMTQSPSSLSASVGDRVTITCQASQDIIKY-LNWYQQTPGKAPKLLI-YEASNLQAGVPSRFSGS--GSGTDYTFTISSLQPEDIATYYCQQYQSLP---YTFGQGTKLQIT............................................................................................................................................... 107
43 -46.700sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  26  1.......XIXMTQSPSSLSASVGDRVTITCRAGQSVNKY-LNWYQQKPGKAPKVLI-FAASSLKSGVPSRFSGS--GSGTDFTLTISGLLPEDFATYYCQQSYTTP---YTFGPGTKVEMT............................................................................................................................................... 107
44 -46.700sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  24  1.......DIQMTQSPSSLSASVGDRVTITCQASQDISDY-LNWYQQKPGKAPKLLI-YDASNLESGVPSRFSGG--GSGAHFTFTISSLQPEDIATYYCQQYDYLP---WTFGQGTKVEIK............................................................................................................................................... 107
45 -46.600sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  26  1.......DIQMTQSPSSLSASVGDRVTITCRASQGI-RNDLTWYQQKPGTAPKRLI-YGATSLQSGVPSRFSGS--GSGTEFTLTINSLQPEDFATYYCLQYSSFP---WTFGQGTKVEVK............................................................................................................................................... 107
46 -46.600sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  26  1.......DIQMTQSPSSLSASVGDRVTITCQASQDINHY-LNWYQQGPKKAPKILI-YDASNLETGVPSRFSGS--GFGTDFTFTISGLQPEDIATYYCQQYDTLP---RTFGQGTKLEIK............................................................................................................................................... 107
47 -46.600sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  28  1.......DIQMTXSPSSLSASVGXRVTITCRASXTISSY-LXWYXXKPGKAPXLLI-YAASXLHSGVPSRFSGS--GSGTXFTFTISSLXPXXFATYYCXXSYSSP---TTFGXGTRLXIK............................................................................................................................................... 107
48 -46.600sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  21  1.......DIQMTQSPSSVSASVGDRVTITCRASQDI-SHWLAWYQQKSGKAPKLLI-YSASSLENGVPSRFSGS--GSGTEFTLTISSLQPEDFATYFCQQAHS---VPLTFGGGTTVDIK............................................................................................................................................... 107
49 -46.600sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  25  1.......DIQMTQSPSSLSASVGDRVTITCQASQDIRKH-LNWYDQKPGKAPRLLI-YGASTLETGVPSRFSGS--GSGTDFTLTISTLQPEDIGNYYCQQYD---NVPITFGQGTRVENKG.............................................................................................................................................. 108
50 -46.500sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  23  1.......DIQMTQSPSTLSASVGDRVTITCRASQSINTW-LAWYQQKPGKAPKLLM-YKASSLESGVPSRFIGS--GSGTEFTLTISSLQPDDFATYYCQQYNS---DSKMFGQGTKVEVKG.............................................................................................................................................. 108
51 -46.500sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  22  1.......DIQMTQSPSSLSASVGDRVTITCRAGHNI-TNFLSWYQQKPGKAPTLLI-YAVSNLQVGVPSRFSGS--GSGAEFTLTISSLQPEDFATYYCQQNYNFS---FTFGGGTKVDNK............................................................................................................................................... 107
52 -46.500sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  23  1......EDIVMTQTPLSLPVTPGEPASISCRSSQSLGNTYLNWYLQKAGQSPQLLI-YTLSYRASGVPDRFSGS--GSGTDFTLKISRVQAEDVGVYYCMQRLEIP---YTFGQGTKLEIR............................................................................................................................................... 114
53 -46.500sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  22  1.......DIQLTQSPSSLSASVGDRVTITCRASQSVYNY-VAWFQQKPGKAPKSLI-YDASTLQSGVPSNFTGS--GSGTDFILTISSLQPEDFATYYCQQYNSYP---YTFGQGTKVQIK............................................................................................................................................... 107
54 -46.500sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  22  1.......DIQMTQSPSSLSATVGDRVTLLCEASQSVGNTFLAWYQQKPKKAPKLLI-YDASNLETGVPSRFSES--GSGTDFTFTISGLXPXXFAVYYCQXYDTLPS---TFGVASKVESK............................................................................................................................................... 111
55 -46.400sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  22  1.......DIVMTQSPDSLAVSLGERATINCKSSQSNNKNYLAWYQQKPGQPPKLLI-YWASTRESGVPDRFSGS--GSGTDFTLTISSLQAEDVAVYYCQQYDTIP----TFGGGTKVEIK............................................................................................................................................... 112
56 -46.400sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  24  1.......DIQMTQSPSTQPASVGDRVTITCRASQSI-NIWLAWYQQKPEKAPKLLI-YKASTLETGVPSRFSGS--GSGTEFTLTINSLQPDDFATYYCQQYSRYP---YTFGQGTKLDIK............................................................................................................................................... 107
57 -46.000sp|P01733|TVB1_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region YT35 OS=Homo sapiens GN=TRBV12-3 PE=1 SV=1  ali follow..  19  2..........VIQSPRHEVTEMGQEVTLRCKPIS--GHNSLFWYRQTMMRGLELLIYFNNNVDSGMPEDRFSAKMP-NASFSTLKIQPSEPRDSAVYFCASSFSTCSANYTFGSGTRLTVV............................................................................................................................................... 114
58 -45.700sp|P01621|KV303_HUMAN Ig kappa chain V-III region NG9 (Fragment) OS=Homo sapiens PE=1 SV=1  ali follow..  25  2....PSGEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLI-YGATSRATGIPDRFSGS--ASGTDFTLTISRLEPEDFAVYYCQQYGNS............................................................................................................................................................... 99
59 -45.500sp|P12018|VPREB_HUMAN(removed signalp:1-19) Immunoglobulin iota chain OS=Homo sapiens GN=VPREB1 PE=1 SV=2  ali follow..  18  1........QPVLHQPPAMSSALGTTIRLTCTLRNDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEEREWEEEMEPTAARTRVP........................................................................................................................................ 126
60 -45.500sp|P01770|HV309_HUMAN Ig heavy chain V-III region NIE OS=Homo sapiens PE=1 SV=1  ali follow..  15  1.......QVQLVQSG-GGVVQPGRSLRLSCAASGFTSRYTIHWVRQAPGKGLEWVAVMSYXGXXDSVNGRFTISRNDSKNTLYLNMNSLRPEDTAVYYCARIRDTAMFFAHWGQGTLVTVSS.............................................................................................................................................. 119
61 -45.300sp|Q5JXA9|SIRB2_HUMAN(removed signalp:1-32) Signal-regulatory protein beta-2 OS=Homo sapiens GN=SIRPB2 PE=2 SV=1  ali follow..  14  2...SSRNDWQVLQPEGPMLVAEGETLLLRCMVVGSCTDGMIKWVKV--STQDQQEIYNFKRGSFPGVMPMIQRTSEPLNCDYSIYIHNVTREHTGTYHCVRFDGLSESEMKSDEGTSVLVKGAGDPEPIQPQELVLGTTGDTVFLNCTVLGDGPPG-PIRWFQGAGLSREAIGISHPKETAVQASNNDFSILLQNVSSEDAGTYYCVKFQRKPNRQYLSGQGTSLKVKAKSTSSKEAEFTSEPATEMSPTGLLAPVVLGLKA.. 269
62 -45.300sp|P01722|LV602_HUMAN Ig lambda chain V-VI region NIG-48 OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.......NLMLIQPP-SVSESPGKTVTMSCTRTSDSASNYVQWYRQRPGGAPTTLI-YDTNQRPYGVPNRFSGSFDSSSNSASLTISGLTNDDTAMYFCQSYDSSNLW--VFGGGTKLTVLS.............................................................................................................................................. 112
63 -45.300sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  19  1........QSVLTQPPSVSGTPGQRVTISCSGGSSTGNNYVYWYQQLPGTAPKLLI-YRDDKRPSGVPDRFSGS--KSGTSASLAISGLRSEDEAHYHCAAWD-YRLSAVVFGGGTQLTVLR.............................................................................................................................................. 112
64 -45.200sp|P01818|HV205_HUMAN Ig heavy chain V-II region HE OS=Homo sapiens PE=1 SV=1  ali follow..  18  1.......QVTLKENG-PTLVKPTETLTLTCTLSGTTDGVAVGWIRQGPGRALEWLAWLLYWDDDPSLKSRLTVTRDTSKNQVVLTMTNMDPVDTATYYCVHRHPRTLAFDVWGQGTKVAVSS.............................................................................................................................................. 121
65 -45.100sp|P06317|LV603_HUMAN Ig lambda chain V-VI region SUT OS=Homo sapiens PE=1 SV=1  ali follow..  15  1.......DFMLTQ-PHSVSESPGKTVIISCTRSDGTAGYYVQWYQQRPGRAPTTVI-FEDTQRPSGVPDRFSGSIDRSSNSASLTISGLQTEDEADYYCQSYDR---DHWVFGGGTKLTVLG.............................................................................................................................................. 111
66 -45.100sp|P06319|LV605_HUMAN(removed signalp:1-19) Ig lambda chain V-VI region EB4 OS=Homo sapiens PE=2 SV=1  ali follow..  15  1.......NFMLTQ-PHSVSESPGKTVTISCTGNSGSASNYVQWYQQRRVSAPTIVI-YEDNQRPLGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSFDNTNQG--VFGGGTKLTVLG.............................................................................................................................................. 112
67 -45.000sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  18  1........QSVLTQPPSASGTPGGRVTISCSGSSSNSNXPAYWYQQLPGTAPKLLI-YNYNQRPSGVPDRFSAS--RSGTSASLAISGLQSEDEADYYCAAWD-DSLDGYVFGTGTKVTVLR.............................................................................................................................................. 112
68 -44.900sp|P83593|KV405_HUMAN Ig kappa chain V-IV region STH (Fragment) OS=Homo sapiens PE=1 SV=1  ali follow..  24  1.......DIVMTQSPDSLVVSLGERATINCRSSQSVNKNYLAWYQQKPGQAPKLLF-SWASTRESGVPDRFSGS--GSGTDFTLTIPGLQAEDVAVYYCQQYYRIP---YTFGQGAK................................................................................................................................................... 109
69 -44.800sp|P06318|LV604_HUMAN Ig lambda chain V-VI region WLT OS=Homo sapiens PE=1 SV=1  ali follow..  15  1.......NFMLTQ-PLSVSGSPEKTVTISCTGSSGSGSNYVQWYQQRPGSAPTNVI-YENNQRPSEVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDNNNH---VVFGGTRLTVLG.............................................................................................................................................. 111
70 -44.800sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  14  1.......HSALTQ-PASVSGSLGQSITISCTGTSSGGYNYVSWFQQHPGTAPKLII-SEVRNRPSGVSDRFSGS--KSANTASLTISGLQAEDEADYYCSSYTSSN--SVVFGGGTKLTVLG.............................................................................................................................................. 111
71 -44.700sp|P01721|LV601_HUMAN Ig lambda chain V-VI region AR OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.......DFMLTQ-PHSVSESPGKTVTFSCTGSGGSADSFVQWYQQRPGSAPTTVI-YDDNQRPSGVPDRFSGSIDDSANSASLTISGLKTEDEADYYCQSYNSNHHV--VFGGGTKVTVLG.............................................................................................................................................. 112
72 -44.700sp|P01824|HV206_HUMAN Ig heavy chain V-II region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  15  1.......RLQLQESG-PGLVKPSETLSLTCIVSGRRTGYYWGWIRQPPGKGLEWIGGVYYTGSNPSLRGRVTISVDTSRNQFSLNLRSMSAADTAMYYCARGNPPPYYDIVWGQGTTVHVSS.............................................................................................................................................. 129
73 -44.700sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  16  1........QSALTQPASVSGSPGQSITISCTGTTSGGYDFVSWYQQHPGKAPKLLI-YDVNSRPSGISNRFSGS--KSGNTASLTISGLQAEDEADYYCSSFT-TTNSRAVFGGGTKLSVLG.............................................................................................................................................. 112
74 -44.700sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  14  1.......QSALTQPP-SASGSLGQSVTISCTGTSSDGYNYVSWYQQHAGKAPKVII-YEVNKRPSGVPDRFSGS--KSGNTASLTVSGLQAEDEADYYCSSYEGSD--NFVFGTGTKVTVLG.............................................................................................................................................. 111
75 -44.700sp|P01773|HV312_HUMAN Ig heavy chain V-III region BUR OS=Homo sapiens PE=1 SV=1  ali follow..  16  1.......QVQLVESG-GGVVQAGTSLRLSCTASAFNSDYAMHWVRQAPGKGLXWVALISYGGSXDSVRGRFTISRXISKXTLYLXMKTLRTEDTAVYYCAKLIAVAGTRXFWGQGTLVTVS............................................................................................................................................... 118

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.