current user: public

If you have questions about the server, please let us know.

Query: sp|Q16775|GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens GN=HAGH PE=1 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# Score Template Links and tools%idFirst MVVGRGLLGRRSLAALGAACARRGLGPALLGVFCHTDLRKNLTVDEGTMKVEVLPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRDLast
1 -115.000sp|Q16775|GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens GN=HAGH PE=1 SV=2  ali  100  1MVVGRGLLGRRSLAALGAACARRGLGPALLGVFCHTDLRKNLTVDEGTMKVEVLPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDDRIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGGSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD 308
2 -104.000sp|Q6PII5|HAGHL_HUMAN Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens GN=HAGHL PE=2 SV=1  ali follow..  41  1................................................MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAGCGSCLEGSAQQMYQSL-AELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKARPLSRRGKRVGGEGTGFGVGGALRQGLMVTGACGHSSASTTPSCGWREYGCCPGASTV 276
3 -97.100sp|Q8N490|PNKD_HUMAN Probable hydrolase PNKD OS=Homo sapiens GN=PNKD PE=1 SV=2  ali follow..  35  75..VGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLF--NGVKVLPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSL-DTVLGLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPYSRAQLLEELRRLKDMHK.... 383
4 -56.800sp|O95571|ETHE1_HUMAN Protein ETHE1, mitochondrial OS=Homo sapiens GN=ETHE1 PE=1 SV=2  ali follow..  22  34..........................................................CTFTYLLGDRESREAVLIDPVTAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHS-----MAFTGDALLIRGCGRFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPAN...................................... 244
5 -33.200sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2  ali follow..  17  27.......................................................TLQGTNTYLV--GTGPRRILIDTGEPSCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEEN-----AIFSGDCILGEGTTVF--EDLYDYMNSL-KELLKIKADI-IYPGHGPVIHNAE---------AKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSN 277
6 -33.100sp|Q68D91|MBLC2_HUMAN Metallo-beta-lactamase domain-containing protein 2 OS=Homo sapiens GN=MBLAC2 PE=1 SV=3  ali follow..  15  32.............................................................IWLVRGSEQ--DVVIDTGGLRSLPEYLYSSGLRPLLAVATHVHFDHSGGLYQFDRVAPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLH-----DKDRKILFSGDVVYDGSLIDWLPYSRISDYVGTCERLIELVDREKVLPGHFNTFGAERLFRLASNYISKAGICHKVSTFAMRSLASLALRVTNSR.......................................... 276
7 -21.000sp|A4D2B0|MBLC1_HUMAN Metallo-beta-lactamase domain-containing protein 1 OS=Homo sapiens GN=MBLAC1 PE=2 SV=1  ali follow..  17  70.............................................................AALE--EAARGPILVDTGAREALLGALAGQGVDVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGP-GLEVWATPGHGGQRDVSVVVAGTALG--VVVAGDVFERDGDEDSWQALSEDPAAQERSRKRVLVVADVVVPGHGPPFRVLREASQPETEGGGNSQQEPVVGDEEPA...................................................... 264
8 -14.100sp|Q6PJP8|DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens GN=DCLRE1A PE=1 SV=3  ali   18  108.....................................................................PGTGFTVDAFQYGVV---------GCTAYFLTHFHSDHYAG---LSKHFTFPVYCSEITG-EQYIHPLPLDTECIVNGVKVVLLDA-NHCPGAVMILFYLPNGTV--ILHTGD----------FRADPSMERSLLAD-----QKVHMLYLDTTYCSPEYTF----PSQQEVIRFAINTAFEAVTLNPHAL-YSIGKEKVFLAIADVLGSKV............................ 298
9 -12.900sp|Q9H816|DCR1B_HUMAN 5` exonuclease Apollo OS=Homo sapiens GN=DCLRE1B PE=1 SV=1  ali follow..  12  11.........................................................................IAVD--------FWSLRRAGTARLFFLSHMHSDHTVG---LSSTWARPLYCSPITA-KQWIQALEVGESHVLETMTVTLLDA-NHCPGSVMFLFEGYFGT---ILYTGD----------FRYTPSMLKEPALTLGKQIH---TLYLDNTNCNPALVLP----SRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWV............................ 201
10 -11.700sp|Q9BQ52|RNZ2_HUMAN Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens GN=ELAC2 PE=1 SV=2  ali   11  18...................................QDGPAPAEKRSQYPEIIFLPMKIRNVSATLVNISPDTSLLLDCGEGTQLCRHYGDQ--TLAAVFVSHLHADHHTGLPSILLQRHPLLVVAPNQLKAWLQERLISSLLRTCDLEEFQTCLVR-HCKHAFGCALVHTSG---KVVYSGDTMPCEALVRMGKDATLLIHEA---TLEDGLEEEAVEKTHSTTSQAISVGMRMNAEFIMLNHFSQRYAKVPLFSPNFSEKVG............................................. 294
11 -11.000sp|Q96SD1|DCR1C_HUMAN Protein artemis OS=Homo sapiens GN=DCLRE1C PE=1 SV=2  ali   12  14.........................................................................ISID---------RFDRENLRARAYFLSHCHKDHMKGLRALECSLKVYLYCSPVTK-TPTQISLVDEASGEKEEIVVTLLPA-GHCPGSVMFLFQGNNGT---VLYTGD----------FRLAQGEAARELLHSGGRVKDIQSVYLDTTFCDPRF---YQIPSREECLSGVLELVRSWITRSPYHVKAAYGYEYLFTNLSEELGVQV............................ 227
12 -9.880sp|Q6IQ20|NAPEP_HUMAN N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Homo sapiens GN=NAPEPLD PE=1 SV=2  ali follow..  16  133............................................ATVMVEMDELIFLTD-----IFSSRASPSQYMGPKRFRRSPCTISE---PIDAVLISHNHYDHLDSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELGHDKVTFVFTPSHWCKRTLMDDNKVLGPWNRFFFAGDT----GYCPAFEEIGKRF-----------PFDLAAIPIGAYEPRWFMKYQHVDPEEAV--RIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDKHGESRYLNNDDENF..... 393
13 -9.740sp|P78559|MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo sapiens GN=MAP1A PE=1 SV=6  ali   32..........................................FLKLSKPCCYIFPGGRGDSALF---AVNGFNILVDGGSDRKSCFWKLVRHLDIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFFNVPEKLRLPDASRKAKRSIEEACLTLQHLNRLGIQAEPLYRVVSNTIEPL--TLFHKM-GVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLPNGKEAEISVPYLTSITALVVWLPANPTEKIVRVLFPGNAPQNKILEGLEKLRDFLRYP.. 292
14 -9.610sp|Q9UKF6|CPSF3_HUMAN Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens GN=CPSF3 PE=1 SV=1  ali   11  8............................................ESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSDDMLYTETDLEESMDKTINFHEVKEVAGIKFWCYHA-GHVLGAAMFMIE----AGVKLLYTGDF---------------------RQEDRHLMAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTDIVNRGGRGLIPVALGRAQELLLILD----EYWQNHPELHDIPIY............... 269

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.