current user: public

If you have questions about the server, please let us know.

Query: sp|Q52M58|CN177_HUMAN Putative uncharacterized protein C14orf177 OS=Homo sapiens GN=C14orf177 PE=2 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MHRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGECSTCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVEQMSQMLast
1 -106.000sp|Q52M58|CN177_HUMAN Putative uncharacterized protein C14orf177 OS=Homo sapiens GN=C14orf177 PE=2 SV=1  ali  100  1MHRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGECSTCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVEQMSQM 125
2 -8.200sp|Q8N6S5|AR6P6_HUMAN ADP-ribosylation factor-like protein 6-interacting protein 6 OS=Homo sapiens GN=ARL6IP6 PE=1 SV=1  ali follow..  20  6..........SGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLP.................................... 84
3 -6.560sp|Q9Y4D7|PLXD1_HUMAN(removed signalp:1-46) Plexin-D1 OS=Homo sapiens GN=PLXND1 PE=1 SV=3  ali   15  200....................EQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDQLGKDSPTNKLLYAKEI------PEYRKIVQRYYKQIQDM 299
4 -6.070sp|P59091|CU093_HUMAN Uncharacterized protein C21orf93 OS=Homo sapiens GN=C21orf93 PE=5 SV=1  ali follow..  23  34......................GPRVMLSSLCREHPWQGRCPEVRQLRHLHRTRPPDTHQDMARGPGLPHTHGLPARPSHVRHQTEPSDGLCRHQLLHPPLVPALGA.................. 139
5 -5.800sp|Q6UW32|IGFL1_HUMAN(removed signalp:1-24) Insulin growth factor-like family member 1 OS=Homo sapiens GN=IGFL1 PE=1 SV=1  ali follow..  17  37.........................................................VPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCR..................... 83
6 -5.670sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=1 SV=2  ali   17  1............................TIPRCGHEQMVPCSVPESDFCCQE------PCSKSLRCGHRCSHPCGEDCVQLCSEMVTIKLKCGHSQPV........................... 64
7 -5.560sp|Q9H772|GREM2_HUMAN(removed signalp:1-21) Gremlin-2 OS=Homo sapiens GN=GREM2 PE=1 SV=1  ali follow..  11  33.....................ASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCA-FCKPQRVTSVLVELECPG................. 118
8 -5.510sp|Q9P0U4|CXXC1_HUMAN CpG-binding protein OS=Homo sapiens GN=CXXC1 PE=1 SV=2  ali   35  1.........................................PSQHHQQQQQQIKR------SARMCGECEACRRTEDCGHCDFCRDMKK.................................... 42
9 -5.480sp|O60565|GREM1_HUMAN(removed signalp:1-24) Gremlin-1 OS=Homo sapiens GN=GREM1 PE=1 SV=1  ali follow..  11  67.....................................RDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCS-FCKPKKFTTMMVTLNCP.................. 135
10 -5.330sp|P98160|PGBM_HUMAN(removed signalp:1-21) Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens GN=HSPG2 PE=1 SV=4  ali   20  1..............................PRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHCELCECNGHSDLC----HPETGAC................................. 58

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.