current user: public

If you have questions about the server, please let us know.

Query: sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHLLast
1 -102.000sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2  ali  100  1MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL 288
2 -57.800sp|Q68D91|MBLC2_HUMAN Metallo-beta-lactamase domain-containing protein 2 OS=Homo sapiens GN=MBLAC2 PE=1 SV=3  ali follow..  17  3.ALEWYAHKSLGDGIFWI--QERFYESGNRANIWLVRGSEQDVVIDTGLGLRSSGLLQDREAKEDAARRPLLAVATHVHFDHSGGLYQFDRVTWLSDSEVVRTPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLIDWSRISDYVGTCERLIELLVEKVLPGHFNTFGA--ERLFRLASNYISKAGICHKVSTFA---MRSLASLALRVTNS........................................ 275
3 -37.900sp|O95571|ETHE1_HUMAN Protein ETHE1, mitochondrial OS=Homo sapiens GN=ETHE1 PE=1 SV=2  ali follow..  25  34.............................CTFTYLLGDREEAVLIDPVL----ETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRL------------SGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLGRTDFQQGCAKTLYHSVEKIFTLPGDCIYPAHD........................................................................................ 196
4 -33.200sp|Q6PII5|HAGHL_HUMAN Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens GN=HAGHL PE=2 SV=1  ali follow..  18  8..........................VLEDNYMYLVELTREAVAVDVAVP------KRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADE------------RIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDALFSGDALSVAGCGSCGSAQQMYQSLAELGTLPPETVFCGHEHTLSNLEAKLSWAKARPLSRRGKRVGGEGTGFGVGQGLMVTGACGHSRRGMRMTCPLCRRLWARSASTTPSCGWREYGCC........ 270
5 -33.200sp|Q16775|GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens GN=HAGH PE=1 SV=2  ali follow..  17  56..........................ALTDNYMYLVDETKEAAIVDPVQP------QKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLKVYGGDD------------RIGALTHKITHLSTLQVGSLNVKCLATPCHTSGHICYFVSKPGAVFTGDTLFVAGCGKFGTADEMCKALEVLGRLPPDTVYCGHEYTINNLKAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD........... 308
6 -31.400sp|Q8N490|PNKD_HUMAN Probable hydrolase PNKD OS=Homo sapiens GN=PNKD PE=1 SV=2  ali follow..  18  126..........................VLSDNYSYLITQAQLAVAVDPSDP------RAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQ-----------DGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGESCLFSGDLLFLSGCGRTGNAETMLSSLDTVLGLGDDTLWPGHEYAEENLGLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGPTGDDDYSRAQLLEELRRLKDM........ 381
7 -29.900sp|A4D2B0|MBLC1_HUMAN Metallo-beta-lactamase domain-containing protein 1 OS=Homo sapiens GN=MBLAC1 PE=2 SV=1  ali follow..  21  67.............................GAEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLVVGTHGHSDHIGNLGLFPG---AALLVSHDFCLPGGRYLPHGLGEGQPLRLGPG----------LEVWATPGHGGQRDVSVVVAGTGTVVVAGDVDSWQALSEDPAAQERSRKRVLVV-ADVVVPGHGPPFR.................................................................................... 236
8 -18.400sp|Q9UKF6|CPSF3_HUMAN Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens GN=CPSF3 PE=1 SV=1  ali   14  24.............................GRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSFKVKVSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHA-GHVLGAAMFMIEGVKLLYTGDILIIESTKREEREARFCNTVHDIVNRGGRGLIPVFA-----------------LGRAQELLLILDEYWQNHPELHDI---IYYASSLAKKCMAVYQTYVNAMNDKIRKQININ........... 300
9 -15.500sp|Q9BQ52|RNZ2_HUMAN Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens GN=ELAC2 PE=1 SV=2  ali   14  33..............IIFLGTGSAIPMKIRNVSATLVNSPDTSLLLDCGEGTFGQLCRHYGDQVDRVLGTLAAVFVSHLHADHHTGLPSILLQRERALASLGKPLHPLKCLQEGAEISSPAVERLISSLLRTCDLEEFQTCLVR-HCKHAFGCALVHTKVVYSGD------TMPCEALVRMGKDATLLDGLEEEAVEKTHSTTVGMRMNAEFIMLNHFSQRYAKVPLFSPNFSEKVGVAFDHM.............................................. 300
10 -15.200sp|Q96SD1|DCR1C_HUMAN Protein artemis OS=Homo sapiens GN=DCLRE1C PE=1 SV=2  ali   15  1............................................MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAYCSPVTKELLLTSPKYRFWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPA-GHCPGSVMFLFQGNNVLYTGDFRLAQGEAARMELLHSGGRVKDIQSVYLDTTFPSREECLSGVLELVRSWITRSPYHVVWLNCKAAYGYE------YLFTNLSEELGVQVH.................................. 228
11 -14.900sp|Q5TA45|INT11_HUMAN Integrator complex subunit 11 OS=Homo sapiens GN=CPSF3L PE=1 SV=2  ali follow..  14  16.............................GRSCILVSIAGKNVMLDCGMHMGFNDDRRFITQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGGPIYMTHPTQAICP-TSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKSESVVYTGDLLITESTSKRCRERDFLKKVHETVERGGKVLIPVFA-----------------LGRAQELCILLETFWERM----NLKVPIY--FSTGLTEKANHYYKLFIPWTNQK................. 289
12 -14.200sp|Q6PJP8|DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens GN=DCLRE1A PE=1 SV=3  ali   14  124....................................................................GCTAYFLTHFHSDHYAG---LSKHFTFPVYCSEITGNLLKNKLHVQEQYIHP---LPLDTECIVNGVKVVLLDA-NHCPGAVMILFYLPNILHTGDFRADPSDQKVHML--YLDTT-----CSPEYTFPSQQEVIRFAINTAFEAVTLNPHKEKVFLAIADV.......................................................... 293
13 -13.900sp|Q9H816|DCR1B_HUMAN 5` exonuclease Apollo OS=Homo sapiens GN=DCLRE1B PE=1 SV=1  ali follow..  11  11..........................................IAVDF----------------LRRAGTARLFFLSHMHSDHTVG---LSSTWARPLYCSPITAHLLHRHLQVSKQWIQA-LEVGESHVLPLETMTVTLLDA-NHCPGSVMFLFEGYFILYTGDEPALTLGKQIHTL--YLDNT-----CNPALVLPSRQEAAHQIVQLIRKHPQHNI--KESLLEQLALEFQTWVVLSPRRLELVQLLGADVFTVEEKAGRIHA....................... 231
14 -13.600sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2  ali   12  17.............................SALCYLLQVDEFRFLLDCGW--DEHFSMDIIDSLRKHVHQIDAVLLSHPDPLHLGALPYAVGKLGCAIYATIPVYKMGQ-TLDDVDAAFDKIQQLKFSQIVNLKGKGHGLSITPGHMIGGTIWKIVEEEIVYAVDF-LSRPSLLITDSEQLLTNVLETLRGDGNVLIAVDT-----------------AGRVLELAQLLDQIWRTKDAGLGVYSLALLN---NVSYNVVEFSKSQVEWMSDK................. 290
15 -11.200sp|Q6IQ20|NAPEP_HUMAN N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Homo sapiens GN=NAPEPLD PE=1 SV=2  ali follow..  12  127.........................VTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPPIDAVLISHNHYDHLNSVIALNERFGNELRWFVP----LGLLDWMQKCGCENVIELDWWEENCVPGHKVTFVFTPSHWCKRWSVLGPWNRFFFAGDTGYCPAFEEIGPIGAY-EAVRIHTDVQTKKSMAIHWGTFAEPPVKLNEALERYGLNAEDFF............................................................... 376
16 -10.900sp|Q9BQ52|RNZ2_HUMAN Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens GN=ELAC2 PE=1 SV=2  ali   18  181............PEIIFLGTGSAIPMKIRNVSATLVNSPDTSLLLDCGEGTFGQLCRHYGDQVDRVLGTLAAVFVSHLHADHHTGLPSILLQ.................................................................................................................................................................................................... 261
17 -10.900sp|P78559|MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo sapiens GN=MAP1A PE=1 SV=6  ali   10  43.........................FPGGRGDSALFAVNGFNILVDGGSDR-----KSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVALEEEQSQGSSSYSDWVKNLISPELGVVFFNVPEKLRLPDASRKAKRSIEEACL---TLQHLNRLGIQAEPLYRVVSNTIEPLTLF----HKMGVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLPNGKEAEISVPYLTSITALV-TEKIVRVLFPGNAPQNKILEGLEKLRHLD............. 287
18 -10.700sp|Q66K74|MAP1S_HUMAN Microtubule-associated protein 1S OS=Homo sapiens GN=MAP1S PE=1 SV=2  ali   70.PPSPFELLEPPTSGGFLRLGRPCCYIFPG-DAAFFAVNGFTVLVNGGSNPKSSFWKLVRHL-----DRVDAVLVTHPGADSLPGLNSLLRRKLAERSEVAAGGGSWDDRLRRLISPNLGVVFFNACEALAQLGITPLPLSRGPVPAKPTVLFEK----MGVGRLDMYVLHPPSAGAERTLASVCALL-----VWHPA------GPGEKVVRVLFPGCTPPACLLDGLVR.......................................................... 297
19 -10.500sp|P46821|MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens GN=MAP1B PE=1 SV=2  ali   115.........................FPGGRGDSALFAVNGFNMLINGGSERKSCFWK-----LIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKSPDLGVVFLNVPENLKNPEPNIKMKRSIEEACFTLQYL-----NKLSMKPEPLFRSVGNTIDPVILFQK---GVGKLEMYVLNPVKS------SKEMQYFMQQWTGTNKD................................................................. 297
20 -10.200sp|Q9H777|RNZ1_HUMAN Zinc phosphodiesterase ELAC protein 1 OS=Homo sapiens GN=ELAC1 PE=2 SV=2  ali follow..  13  1..........MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQLKA-----GRITKIFITHLHGDHFFGLPGLLCTISLQSGSMVSKQPADSPPKEEQGRTILLDSEENSYLLFDDEQFVVKAFRLF-HRIPSFGFSVVEKGKLKNGISVVLENGVTISPGVKLCFEADLLDAQMDKAKEHGHSTPFAKLCRAKRLVLTHFSQRYKPVALAREGETDGIAELKKQAESVLDL........................................ 345
21 -9.720sp|Q6PJP8|DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens GN=DCLRE1A PE=1 SV=3  ali   22  252......................PFYKKIPGTG----------FTVDA-----------------GVVEGCTAYFLTHFHSDHYAG---LSKHFTFPVY.............................................................................................................................................................................................. 300

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.