current user: public

If you have questions about the server, please let us know.

Query: sp|Q5T6J7|GNTK_HUMAN Probable gluconokinase OS=Homo sapiens GN=C9orf103 PE=2 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MAAPGALLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKMKLast
1 -99.500sp|Q5T6J7|GNTK_HUMAN Probable gluconokinase OS=Homo sapiens GN=C9orf103 PE=2 SV=1  ali  100  1MAAPGALLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKMK 187
2 -30.300sp|Q8IYQ7|THNS1_HUMAN Threonine synthase-like 1 OS=Homo sapiens GN=THNSL1 PE=1 SV=2  ali   11  52LVGDKNIILMGPPGAGKTTVGRIIGQKLGCCVIDVDDILEKTWNMSVSEKLQDVGNEQFLEEEGKAVLNFSA-SGSVISLTGSNPMHDASMWHLKKNG---------------------IIVYLDVPLLDLICRLKLMKTDRISGTSMKDLLKFRRQYYKKWYDARVFCGASPEEVADKVLNAIKR. 222
3 -27.600sp|Q9Y3D8|KAD6_HUMAN Adenylate kinase isoenzyme 6 OS=Homo sapiens GN=TAF9 PE=1 SV=1  ali follow..  23  1MLLPN-ILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQ---LYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWF--------------------------IVFVLRTDTNVLYERLETRGYN-IQCEIFQVLYEEATASYKEEIVHQLP-SNKPEELENNVDQILK.. 161
4 -21.200sp|O00142|KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens GN=TK2 PE=1 SV=4  ali follow..  13  47KEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSFVENLYRSGKMPEVDYVVLSEWFDWILRNMLIVYLRTNPETCYQRLKKRCREEIPLEYLEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDR. 254
5 -20.300sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6  ali   14  45.KDCEVVMMIGLPGAGKTTWVTKHAAENKYNILGTNTIMDKMMVAGFKKQMADTGKLNT--PQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGF----------------QRKAVVVCPKDEDYKQRTQKKAGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEE 222
6 -20.100sp|Q16854|DGUOK_HUMAN Deoxyguanosine kinase, mitochondrial OS=Homo sapiens GN=DGUOK PE=1 SV=2  ali follow..  14  36.RGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMMPFPEKLLQARKPVQIFERSVYSDRFAKNLFENGSLSDIEWHIYQDWHSFLLWEFGFIYLQASPQVCLKRLYQR-AREEEKGIELAYLEQLHGQHEAIPVLVLDVNDDQEDLMREVNTFVKN. 276
7 -18.400sp|Q8IV42|PSTK_HUMAN L-seryl-tRNA(Sec) kinase OS=Homo sapiens GN=PSTK PE=2 SV=2  ali follow..  17  16.RKRGLCVLCGLPAAGKSTFARALAHRLQQEVVAYDDVMPDAFLAGARARPAPSQWKLLR-AQSCYLLTKTAVSRPLFLVLDDNFYYQSMRYEVYQLA--------------RKYSLGFCQLFLDCPLETCLQRNGQRPQA-LPPETIHLMGRKLEKPNPEHNSLTIPSPACASEASLEVTDLLLT. 245
8 -18.200sp|Q5TBK1|N42L1_HUMAN NEDD4-binding protein 2-like 1 OS=Homo sapiens GN=N4BP2L1 PE=2 SV=1  ali follow..  11  40.FRKHLYLLRGLPGSGKTTLARQLQHD-RALIFSTDDFFFREDGA-----YEFNPDFLEEAHEWNQKRARKAMRNGISPIINTNLHAWEMKPYAVMA---------------LENNYEVIFREPDTRWKFNVQELARRNIHGVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNN 208
9 -17.900sp|P27707|DCK_HUMAN Deoxycytidine kinase OS=Homo sapiens GN=DCK PE=1 SV=1  ali follow..  12  19.TRIKKISIEGNIAAGKSTFVNILKQLCEWCNVQSTQDEFEELTMSQKNGGNVLQEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETGIIYLQATPETCLHRIYLR-GRNEEQGIPLEYLEKLHYKHESVPILTLDVNEDFKDKYESLVEKVKE. 255
10 -17.900sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens GN=HNRNPUL2 PE=1 SV=1  ali   13  1..ECEVILMVGLPGSGKTQWALKYAKEKRYNVLGAETVLNQMRMKGLEEPEMDPKS-----SQCLSKLVQIASRTKRNFILDQCNVYNSGQRRKLLLFKTF----------------SRKVVVVVPNEEDWKKRLELREGDDVPESIMLEMKANFSLPEKCDYMDEVTYGELEKEEAQPIVTKYKEE 178
11 -17.700sp|O95299|NDUAA_HUMAN(removed signalp:1-20) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens GN=NDUFA10 PE=1 SV=1  ali follow..  14  35.ERSRVITVDGNICTGKGKLAKEIAEKLGFKHFDSTTGDGKPLATDYNGNCSLEDPRSND-LLQYSDALEHLLTTGQGVVLERSIFSDVFLEAMYNQGFIRKQCVDHYNEVKSVTICDYLVIYIDVPVPEVQRRIQKKGDPHEMKQDIENAYKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEY. 255
12 -17.700sp|O95340|PAPS2_HUMAN Bifunctional 3`-phosphoadenosine 5`-phosphosulfate synthase 2 OS=Homo sapiens GN=PAPSS2 PE=1 SV=2  ali   15  41..RGCTVWLTGLSGAGKTTISFALEEYLPCYSLDGDNVR-----HGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARK--------------IHESAGLPFFEIFVDAPLNICESRKRARAGEIKGFTGIDSDYEKPETPE-----RVLKTNLTVSDCVHQVVELLQEQ 213
13 -17.400sp|O43252|PAPS1_HUMAN Bifunctional 3`-phosphoadenosine 5`-phosphosulfate synthase 1 OS=Homo sapiens GN=PAPSS1 PE=1 SV=2  ali   17  50.FRGCTVWLTGLSGAGKTTVSMALEEYLPCYTLDGDNIR-----QGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQ--------------IHEGASLPFFEVFVDAPLHVCEQRKKARAGEIKGFTGIDSEYEKPEAPE-----LVLKTDSDVNDCVQQVVELLQER 223
14 -17.400sp|P30085|KCY_HUMAN UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3  ali follow..  16  2..KPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVS--------------FVLFFDCNNEICIERCLERGK---NRESLEKRIQTIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKE 195
15 -17.100sp|Q9NWW6|NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens GN=NRK1 PE=1 SV=1  ali follow..  13  2..KTFIIGISGVTNSGKTTLAKNLQKHLNCSVISQDDFFKPESEIETDKNGFLQDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRS-------YFLTIPYEECKRRRSTRVYQYFDGHVWPMYLKYRQEMQDITWEVVLDGTKSEEDLFLQVYEDLIQE 188
16 -16.900sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   16  59.TVPIRIIIVGPPKSGKTTVAKKITSEYGLKHLSIGGALRYVLNNHLHKGMTAPDE-----IQALELSLMESVCNTAGVVIDGYPVTKHQMNLLEARSIIPM-----------------VIFELSVPSKEIFKRLLLEKEN--SAQIVAVNNVKYRK-EQHQNWYVIDGFHSKWWVWNEVIKNVQM. 252
17 -16.800sp|Q96EK9|KTI12_HUMAN Protein KTI12 homolog OS=Homo sapiens GN=KTI12 PE=1 SV=1  ali follow..  15  1MP---LVVFCGLPYSGKSRRAEELRVALAAEGRAVYVVDDAAVLGAEDPAVYGDSAREKALRGALRASVERRLSRHDVVILDSLNYIKGFRYELYCLA--------------RAARTPLCLVYCVRPGGPIAGPQVAGANENPGRNVSVSWRPRAEEDGRAQA........................ 146
18 -16.700sp|P00568|KAD1_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens GN=AK1 PE=1 SV=3  ali follow..  15  5LKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPT-----------------LLLYVDAGPETMTQRLLKRGE---NEETIKKRLETIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDA. 192
19 -16.700sp|Q15126|PMVK_HUMAN Phosphomevalonate kinase OS=Homo sapiens GN=PMVK PE=1 SV=3  ali follow..  11  7.APRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRL------------------------GPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQAVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPG-VDDAESECGLDNFG-----DFDWVIENHGVEQRLLENLIEFIRSR 191
20 -16.100sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2  ali   16  138.VGLVLVLLRGLPGSGKSFLARTLQED-SGVILSTDDYFYINGQYQFDVKY----------LGEAHEWNQNRAKE---------AFEKKISPIIIDNTNLQAWEMKPYVALSQKHKYKVLFREPDTWWKFKPKELARRNIHGVSKEKITRMLEHYQRFVSVPIIMSSSVPEKIERI........... 294
21 -15.800sp|Q96T60|PNKP_HUMAN Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens GN=PNKP PE=1 SV=1  ali follow..  15  363.ASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTT---------------------CETALKQGKRVAIDNTNPDAASRARYVQCA--------------RAAGVPCRCFLFTATLEQARHNNRFREMT-VSDMVMYGYRKQFEAPTLAEGILEIPFRLWVEPRLGRLYCQF... 518
22 -15.700sp|Q9NPI5|NRK2_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens GN=ITGB1BP3 PE=1 SV=1  ali follow..  11  4.....IVGIGGMTNGGKTTLTNSLLRALNCCVIHQDDFFKPQD-------IAVGEDGFKQWDVLESLDMEAMLDTVQAWLSSPQKFARAHGVSVQPEASDTHILLLEGFLLYSYKPLVDLYYFLTVPYEECKWRRSTRNYTLFDGHVWPMYQKYRQEMEANGVEVVLDGMKSREELFREVLEDIQNS 190
23 -15.500sp|P09543|CN37_HUMAN 2`,3`-cyclic-nucleotide 3`-phosphodiesterase OS=Homo sapiens GN=CNP PE=1 SV=2  ali follow..  17  47LECKTLFILRGLPGSGKSTLARVIVDK-GTKMVSADAYK-------------ITPGARGAFSEEYKRLDEDLAA---------YCRRRDIRILVLDDTNHERERLEQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEK.............................. 183
24 -14.600sp|Q16774|KGUA_HUMAN Guanylate kinase OS=Homo sapiens GN=GUK1 PE=1 SV=2  ali follow..  17  1MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTS--KVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQ-SLHVLEQRLRQRNTE---VKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEE 188
25 -14.500sp|Q96M32|KAD7_HUMAN Putative adenylate kinase 7 OS=Homo sapiens GN=AK7 PE=2 SV=3  ali   13  66..MPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAKESMEQNAGQLDDQ-----IRFMKEKLKSMPCRNQGYILDGFPKTYDQAKDLFNQEDEEEEDDVRGRMFPFDKLIIPFVCALDASDEFLKERVINLPESIVSQDRFLRALSNYRDINIDDETVF..................... 271
26 -14.500sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   27LSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAELISGQSIPDE-----IKLMLEKLNSPEVCHFGYII----------TEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQR................................................ 162
27 -14.400sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2  ali   13  160LTGTSSVLLRGPPGCGKTTVVAAACSHLGLHLLKVP-------------------------------------------------------SLCAESSGAVETKLQAIFSRARRCRPAVLLL----AVDLLGRDRDGLGEDARVMAVLRHLLLNEDPLNSCPPLMVVATTSRAQDLPADVQTAFPHE 290
28 -14.400sp|P23919|KTHY_HUMAN Thymidylate kinase OS=Homo sapiens GN=DTYMK PE=1 SV=4  ali follow..  11  3ARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRASSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQ------GVTLVVD---RYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLKMVDASKSIEAVHEDIRVLSEDA 198
29 -13.900sp|Q9Y6K8|KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens GN=AK5 PE=1 SV=2  ali follow..  12  373LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASEMERGDLVPSG-----LELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQ-----------------LVICMDCSADTMTNRLLQRSR---TTKTIAKRLEAYYR-ETKTQLHKINAEGTPEDVFLQLCTAIDS. 560
30 -13.600sp|Q96MA6|CI098_HUMAN Putative adenylate kinase-like protein C9orf98 OS=Homo sapiens GN=C9orf98 PE=2 SV=1  ali follow..  16  266.PFTPRVLLLGPVGSGKSLQAALLAQKYRLVNVCCGQLLKEAVADRTTFGELIQPFFEKE-MKVLSQRLDQQDCIQKGWVLHGVPRDLDQAHLLNRLGYNPN-----------------RVFFLNVPFDSIMERLTLRRIDPVTEEQVKLKMDLFYRNSADGSAITLNGDQDPYTVFEYIESGIINP 473
31 -13.600sp|Q5EBM0|CMPK2_HUMAN UMP-CMP kinase 2, mitochondrial OS=Homo sapiens GN=CMPK2 PE=1 SV=3  ali follow..  11  250.GKFQVVAIEGLDATGKTTVTQSVADSLKAVLLK----SPPSCIGQWRKIFDDEPTIIRRAFYSLGASEIAKESAKSPVIVD-STATYAIATEVSGGLQHLPPAHHPVYQWPEDLLKPDLILLLTVSPEERLQRLQGRGME-EANSVFRQKVEMSYQRMENPGCHVVDASPSREKVLQTVLSLIQNS 445
32 -13.500sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens GN=NSF PE=1 SV=3  ali   11  100CKHVKGILLYGPPGCGKTLLARQIGKMLNAREP------------KVVNGPEILNK---------------------------GESEANIRKLFADA---------EEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLR..... 235
33 -13.400sp|Q9HA47|UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens GN=UCK1 PE=1 SV=1  ali follow..  14  21.QRPFLIGVSGGTASGKSTVCEKIMELLGQNILSQDRFYKVLTAEQKAK-----ALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADYSQEIRDMFHLRLFVDTDSDVLSRRVLRDRRGRDLEQILTQYTTFVKPPTKKYADVIIPRGVDNMVAINLIVQHIQDI 230
34 -13.300sp|Q92802|N42L2_HUMAN NEDD4-binding protein 2-like 2 OS=Homo sapiens GN=N4BP2L2 PE=1 SV=1  ali follow..  15  400.LQKLLILLRGLPGSGKTTLSRILLGQ-DGIVFSTDDYFHHQDGYRYNVNQ----------LGDAHDWNQNRAKQ---------AIDQGRSPVIIDNTNIQAWEMKPYVEVAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYEYQMSISIVM...................... 545
35 -13.200sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2  ali   11  1..............SGKSFLARTLQED-SGVILSTDDYFYING------QYQFDVKYLGEAHEWNQNRAKEAFEKKISPIINTNLQAWEMKPYVALS---------------QKHKYKVLFREPDTWWKFKPKELARRNIHGVSKEKITRMLEHYQR.............................. 125
36 -12.900sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2  ali   13  10LTGTSSVLLRGPPGCGKTTVVAAACSHLGLHLLKVP-------------------------------------------------------SLCAESSGAVETKLQAIFSRARRCRPAVLLL----AVDLLGRDRDGLGEDARVMAVLRHLLLNEDPLNSCPPLMVVATTSRAQDLPADVQTAFPHE 140
37 -12.700sp|Q8N3R9|MPP5_HUMAN MAGUK p55 subfamily member 5 OS=Homo sapiens GN=MPP5 PE=1 SV=3  ali   12  27.NRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTS--IDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPSQERLRALLAKEGKNPKPEELIIEKTREMEQNNGHYFDTAI-VNSDLDKAYQELLRLINKL 212
38 -12.600sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   20  89.GPPCKVFILGPQYSGKTTLCNMLAENYKGKVVDYAQLVQPRFDKARET.......................................................................................................................................... 136
39 -12.500sp|Q9BZX2|UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens GN=UCK2 PE=1 SV=1  ali follow..  12  18.GEPFLIGVSGGTASGKSSVCAKIVQLLGQNILSQDSFYRVLTSEQKAK-----ALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADYSQEVRDLFQMKLFVDTDADTLSRRVLRDISE--LEQILSQYITFVKPPTKKYADVIIPRGADNLVAINLIVQHIQD. 227
40 -12.400sp|Q8WVC6|DCAKD_HUMAN Dephospho-CoA kinase domain-containing protein OS=Homo sapiens GN=DCAKD PE=1 SV=1  ali follow..  13  1......MFLVGLTGSGKSSVIQVFQQ-LGCAVIDVDVMARHVVQPGYPAGTEVLLENGDINRKVLGDLIFNQPDRR-------QLLNAITHPEIRKEMMKETFKYFLRGYRYVILDIPLLFVVVYCDRDTQLARLMRRNS---AEARINAQLPLTDKA--RMARHVLDNSGEWSVTKRQVILLHTE. 195
41 -12.300sp|O76031|CLPX_HUMAN ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens GN=CLPX PE=1 SV=2  ali   17  135..EKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICD--DANYNVEKAQQGIVFLDE----------DKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVASGARIISRRKNEKY................................................ 288
42 -12.200sp|Q9H3H1|MOD5_HUMAN tRNA dimethylallyltransferase, mitochondrial OS=Homo sapiens GN=TRIT1 PE=1 SV=1  ali follow..  16  21.RTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVYEGLDIITNKVSAQEQRICRFRNRATALIEDIFARDKIPIVVGGTKRKVARQVFEETGISHSEFLHRQHTEEGGGPLNPCILWLHADQAVLDERLDKRVDDMLAAGLLEELRDFHR............................... 261
43 -12.100sp|Q9H7X7|RABL5_HUMAN Rab-like protein 5 OS=Homo sapiens GN=RABL5 PE=2 SV=1  ali follow..  12  6......ILFVGPCESGKTVLANFLTESQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMK---DAHGVVIVFNADIPSHRKEMEM-----------SCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLS--------LSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSES 175
44 -12.000sp|P54819|KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens GN=AK2 PE=1 SV=2  ali follow..  13  13.PKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGMDAGKLVSDE-----VVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLD-------------SVIEFSIPDSLLIRRITGRLIH--NEKALKIRLQAIEYYRKRGIHSAIDASQTPDVVFASILAAFSKA 230
45 -12.000sp|Q9BSD7|CA057_HUMAN Nucleoside-triphosphatase C1orf57 OS=Homo sapiens GN=C1orf57 PE=1 SV=1  ali follow..  12  2...ARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRR-VTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNA------------DCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPPKGKPLALVEEIRNRKDVKVFNVTENRNHLLPDIVTCVQS. 187
46 -11.900sp|A6NCM1|IQCAL_HUMAN Putative IQ and AAA domain-containing protein 1-like OS=Homo sapiens GN=IQCA1L PE=5 SV=2  ali   13  110....RSILLVGPSGMGKKMLVKAVCTETGANLFD-----SPENLLGKYPG----------------------RNGAQMMVHIVFKVARLLQPSV---------------------------IWIGNAEKNFYKKTPKEDKEMDPKRIKKDLTKALRLLTPGDRVMLIGTTSRPQLAEMRGLCRVYER 239
47 -11.800sp|P27144|KAD4_HUMAN Adenylate kinase isoenzyme 4, mitochondrial OS=Homo sapiens GN=AK4 PE=1 SV=1  ali follow..  16  3.SKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMA---------KQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVD----LVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDV 177
48 -11.800sp|P49750|YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens GN=YLPM1 PE=1 SV=3  ali   12  136RPERIVVIMRGLPGSGKTHVAKLIRDK-APRVLSLDDYFSGKKVKKKVMEYEYEAEMEETYRTSMFKTFKKTLDDGFFPFIILDAINDRVRHF------------DQFWSAAKTKGFEVYLAEMSADNQTCGKR----NIHGRKLKEINKMADHWET.............................. 294
49 -11.700sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   11  30......VLIQGETSVGKTSLIQWLAAATGNHCVR--NNHEHTDIQEYIGCYTSDSSGKLVFKEGV---LIDAMRKGYWIILELNLAPTDVLEALNRLLDDNRELLVTETQEVVKAHPRFMLFATQNPPGLYGGR------KVLSRAFRNVELHFDELPSSELETILHKRCSLPPSYCSKLVKVMLD. 202
50 -11.700sp|Q15645|TRP13_HUMAN Thyroid receptor-interacting protein 13 OS=Homo sapiens GN=TRIP13 PE=1 SV=2  ali follow..  14  169ITWNRVVLLHGPPGTGKTSLCKALAQKLTIR-------------------------------------LSSRYRYGQLIEINSHSLFSKW-----SESGKLVTKMFQKIQDLIDDKDALVFVLIDEVESLTAARNACRAGT--AIRVVNAVLTQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIK 316
51 -11.600sp|Q9UIJ7|KAD3_HUMAN GTP:AMP phosphotransferase, mitochondrial OS=Homo sapiens GN=AK3 PE=1 SV=4  ali follow..  20  5.ARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKL----------IPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQID---TVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQ 179
52 -11.600sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2  ali   11  136..RRSGLLLHGPPGTGKTLLAKAVATECSLTFLS--------------------------------------VKGPELINMYVGQSEENVREVFARARAAAP-----------------CIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQDVFVIGATNRPDLLDPALLR..... 260
53 -11.500sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   16  91...PLRICLVGPQGSGKTMCGRQLAEKLNIFHIQFEEVLQEKLLLKLMENEPLPPE-----EVILSEWWLKEPIRSTGFILDGFPRYPEEAQFLGDRGFFPD-----------------AAVFIQVDDQDIFDRLLPAQ................................................ 264
54 -11.400sp|Q9C093|SPEF2_HUMAN Sperm flagellar protein 2 OS=Homo sapiens GN=SPEF2 PE=1 SV=2  ali   12  39FSAGPVSDEVLPETEGETMLSANADKTPKAEEVKSSDSFLKLTTRALKKGKSIPDV-----LVDIIVNAINEIPVNQDCILDGFPMTLNQAQLLEEALTGCNRNLTEVERKKAQKSTLAFVILLDVSDTSSMSRMNDII-----RDQIQHRIIGFLDNWPLLEQIKINAEIDKESLCEKVKEILTTE 281
55 -11.400sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1  ali   15  162LVTPAGVLLAGPPGCGKTLLAKAVANESGLNFI--------------------------------------SVKGPELLNMYVGESERAVRQVFQRAKNSAPC-----------------VIFFDEVDALCPRRSDRETG--ASVRVVNQLLTEMDGLEARQQVFIMAATNRPDIIDPAILR..... 286
56 -11.400sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3  ali   13  58IQPPKGVLLYGPPGCSKTMIAKALANESGLNFLA--------KGPELMNKYVGESE---------------------------RAVRETFRKARAVAPS---------------------IIFFDELDALAVERGSSLGAGNVADRVLAQLLTEMDGIEQLKDVTILAATNRPDRIDKALMR..... 184
57 -11.400sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   14  243TKLKKPILLEGSPGVGKTSLVGALAKASGNTLVR--NLSEQTDITDLFGADLPVEGGK................................................................................................................................. 299
58 -11.300sp|Q8IVL0|NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens GN=NAV3 PE=1 SV=3  ali   11  96LMEHHRIILSGPSGTGKTYLANKLAEYV--------TKSGRKKTEDAIATFNVDHKSSKELQQYLANLAADNNGVELPVVIILDNLHHSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLET. 280
59 -11.200sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1  ali   15  12LVTPAGVLLAGPPGCGKTLLAKAVANESGLNFIS--------------------------------------VKGPELLNMYVGESERAVRQVFQRAKNSAPC-----------------VIFFDEVDALCPRRSDRETG--ASVRVVNQLLTEMDGLEARQQVFIMAATNRPDIIDPAILR..... 136
60 -11.200sp|Q96M69|LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens GN=LRGUK PE=1 SV=1  ali   13  112.APYPMLILAGPEACGKRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFISQDVFDEMVNMGKFILTFSYGNHKYGLN--RDTVEGIARDGLASCIHMEIEGVRSLKYSYFEPRYILV--NKEKYEGYLRRKGLF-VSRVDLYIKINQNFPGYFDEVINADDLDVAYQKLSQLIREYL... 300
61 -11.200sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   13  93TKLKKPILLEGSPGVGKTSLVGALAKASGNTLVR--NLSEQTDITDLFGADLPVEGGKGGEFAWRDGPLLAALKAGHWVVLASQSVLEGLNACFDHRG---EIYVPELGMSFQVQHEKTKIFGCQNPFRQGGGR------KGLPRSFLNRFTQVVDPLTVIDMEFIASTLFPEKNIVKKMVAFNNQ. 276
62 -11.100sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens GN=CHTF18 PE=1 SV=1  ali   16  65.PKQKVALLCGPPGLGKTTLAHVIARHAGYSVVESDDRSPEVFRTRIEAATQMESVLGAGGKPNCLVIDEIDGAPVAAINVLLSILNRKGPQEVGPQGPAVPSGGGRRRRAEGGLLMRPIICICNDQFAPSLRQLKQQA-PPTLPSRLVQRLQEVQGMRADPGVLAALCEKTDNDI-RACINTLQ.. 257
63 -11.000sp|Q8NEY1|NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens GN=NAV1 PE=1 SV=2  ali   12  48LLKHRRLVLSGPSGTGKTYLTNRLAEYL--------ERSGREVTEGIVSTFNMHQQSCKDLQLYLSNLARETGIGDVPLVILLDDLSEAGSELVNGALTCKYHKCPYIIGTTNQPVKMTPNHGLHLSFRMLTFSNNVEPANGFLVRYLRRKLVESDSDINANKEELLRVLDWVPKLWYHLHTFLEK. 232
64 -11.000sp|Q86XH1|IQCA1_HUMAN IQ and AAA domain-containing protein 1 OS=Homo sapiens GN=IQCA1 PE=2 SV=1  ali   13  119....KSLLLAGPSGVGKKMLVHAICTETGANLFN-------------------------------------SSSNIAGKYPGKNGLQMMLHAVFKVARQLQPS-----------------VVWIEDTEKTFYKKVPNAEKMNEPKRLKKHLPQILKLLKPDDRILIVGTTRRPFDAELQSFCKVYQK 248
65 -10.900sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   11  67VSKGEPVLLVGETGTGKTSTIQYLAHITGHRLRVVNMNQQSDTADLLGGYKPVDHKLIWLPLREAFEELFAQTFSKKQNFTFLGHIQTCYRQLMQHVHKSAVNKDGKDSETGLLIKEKWEAFGLRLNHAQQQMKMTENTLLFLAQAVKKGEWILLD-----------EINLAAPEILECLSGLLEGS 256
66 -10.800sp|O75943|RAD17_HUMAN Cell cycle checkpoint protein RAD17 OS=Homo sapiens GN=RAD17 PE=1 SV=2  ali   30  128.QGGSILLITGPPGCGKTTTLKILSKEHGIQVQE......................................................................................................................................................... 160
67 -10.800sp|Q5SY16|NOL9_HUMAN Polynucleotide 5`-hydroxyl-kinase NOL9 OS=Homo sapiens GN=NOL9 PE=1 SV=1  ali   15  1.....VILVCGSQDVGKSTFNRYLINHLCVDYLECDEFTPPGCISLLNITEPVLGNNYENYIDIVKYVFSAYKRESPLIVNTMGWVSDQGLLLLID........................................................................................... 121
68 -10.700sp|Q96M32|KAD7_HUMAN Putative adenylate kinase 7 OS=Homo sapiens GN=AK7 PE=2 SV=3  ali   14  216..MPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGE----EEEVEEEEEEENVEDAQELL--DGIKESMEQ............................................................................................... 300
69 -10.700sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2  ali   13  81LAVPRGVLLAGPPGVGKTQLVRAVAREAGAELL--------------------------------------AVSAPALQGSRPGETEENVRRVFQRA------------RELASRGPSLLFL------DEMDALCPQRGSRAPESRVVAQVLTLLDGASGDREVVVVGATNRPDALDPALRR..... 206
70 -10.600sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   23  209.TVPIRIIIVGPPKSGKTTVAKKITSEYGLKHLSIGGALRYVLNNHLHKGMTAPDE-----IQALELSLMESVCNTAGVVI.......................................................................................................... 297
71 -10.500sp|Q96QE3|ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens GN=ATAD5 PE=1 SV=4  ali   21  76....NTVLITGPTGVGKTAAVYACAQELGFKIFESSQRSGRQILSQLKEAT........................................................................................................................................ 125
72 -10.500sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens GN=NSF PE=1 SV=3  ali   18  83RTPLVSVLLEGPPHSGKTALAAKIAEESNFPFI---------KICSPDKMIGFSETAK------------------------CQAMKKIFDDAYKSQLS---------------------CVVVD-DIERLLDY--VPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEM....... 205
73 -10.400sp|Q86XH1|IQCA1_HUMAN IQ and AAA domain-containing protein 1 OS=Homo sapiens GN=IQCA1 PE=2 SV=1  ali   26  265APLVKSLLLAGPSGVGKKMLVHAICTETGANLFN......................................................................................................................................................... 298
74 -10.400sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4  ali   13  58MTPSKGVLFYGPPGCGKTLLAKAIANECQANFIS--------------------------------------IKGPELLTMWFGESEANVREIFDKARQAAPC-----------------VLFFDELDSIAKARGGNIGDG-AADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILR..... 185
75 -10.400sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6  ali follow..  12  37.NCPTLIVMVGLPARGKTYISKKLTRYLNW-FNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVEGGHVAVFDATNTTRERRATIFN--------------FGEQNGYKTFFVYVNRDSDEATEDFMRRIECY------ENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSR 237

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.