current user: public

If you have questions about the server, please let us know.

Query: sp|Q6PL24|TMED8_HUMAN Protein TMED8 OS=Homo sapiens GN=TMED8 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst MSDLQAAEGPGSWSPTARPGSAGGVGDCQGVEGSQAAASENEDLENKDTSLLASATDPEPCSSPHRPQMVSPVSKDATEDLRKATGPLEAQALVKQDLLPADQAQVLNEMAKYQVPQRSGDIVMIQSEHTGAIDVLSADLESADLLGDHRKVSPPLMAPPCIWTFAKVKEFKSKLGKEKNSRLVVKRGEVVTIRVPTHPEGKRVCWEFATDDYDIGFGVYFDWTPVTSTDITVQVSDSSDDEDEEEEEEEEIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYTSLast
1 -105.000sp|Q6PL24|TMED8_HUMAN Protein TMED8 OS=Homo sapiens GN=TMED8 PE=1 SV=1  ali  100  1MSDLQAAEGPGSWSPTARPGSAGGVGDCQGVEGSQAAASENEDLENKDTSLLASATDPEPCSSPHRPQMVSPVSKDATEDLRKATGPLEAQALVKQDLLPADQAQVLNEMAKYQVPQRSGDIVMIQSEHTGAIDVLSADLESADLLGDHRKVSPPLMAPPCIWTFAKVKEFKSKLGKEKNSRLVVKRGEVVTIRVPTHPEGKRVCWEFATDDYDIGFGVYFDWTPVTSTDITVQVSDSSDDEDEEEEEEEEIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYTS 325
2 -70.800sp|Q9H3P7|GCP60_HUMAN Golgi resident protein GCP60 OS=Homo sapiens GN=ACBD3 PE=1 SV=4  ali follow..  30  209.KEEEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQA-VVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPV--IAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEEN---------IGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR 528
3 -55.500sp|Q9BQS8|FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=FYCO1 PE=1 SV=2  ali   12  7............CNNYVLSKHGGKKERCCRACFQKLSEGPGSPDSSGSGTSQGEPSPALSPASPGPQATGGQGANTDYRPPDDAVFDIITDE---------------ELCQIQESGSSLPETPTETDSLDPNAAEQDTTSTSLTPEDTEDMPVGQDS-SGELMIKVPLTVDEIASFGEGSRELFVRSSTYSLIPITVAEAGLTISWVFSSDPKSISFSVVFQEAEDTPL-----------------------------------------DQCKVLIPTTRCNSHKENIQGQLKVRTPGIYMLIFDNTFSRFVSKKVFYHLTVDR 268
4 -48.600sp|O76054|S14L2_HUMAN SEC14-like protein 2 OS=Homo sapiens GN=SEC14L2 PE=1 SV=1  ali follow..  17  173....................................................................EFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVL-GANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDI----PRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQ---------------------------------------RAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLL 385
5 -48.300sp|Q9UDX4|S14L3_HUMAN SEC14-like protein 3 OS=Homo sapiens GN=SEC14L3 PE=2 SV=1  ali follow..  17  172...................................................................QEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVL-GNNWKEGLLKLISPEELPAQFGGTLTDPDGNPKCLTKINYGGEI----PKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFLKTKMGERQ---------------------------------------RAGEMTDVLPSQRYNAHMVPEDGNLTCSEAGVYVLRFDNTYSFVHAKKVSFTVEVLL 385
6 -48.000sp|Q9UDX3|S14L4_HUMAN SEC14-like protein 4 OS=Homo sapiens GN=SEC14L4 PE=2 SV=1  ali follow..  17  173....................................................................QFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVIL-GDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEV----PKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQ---------------------------------------SAREMTEVLPSQRYNAHMVPEDGSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLL 385
7 -45.700sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3  ali   12  6.......................................................................................................................QGPGGLVDYLDREVIPDFLGGESVCNVPEGGL------VPKSLYMTEEEQEHTDQLWSETYHSASVLRGAPHEVAVEILEGESVITWDFDILRGDVVFSLYHTKQAPRLGAREPG----------------------------------TRASGQLIDKGWVLGRDYSRVQGSHVTRWPGVYLLQWQMHSPPSSVACSLPGVDDVL 185
8 -44.500sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SEC14L1 PE=1 SV=2  ali   11  1.....................................................................................................FIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECMCEVPEGGLVPKSLYRTAE----ELENEDLKLWTETIYQSASVFKGAPHEILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGN--------------NVQLIDKVWQLGRDYSMVESPLICKEGESVQGSHVTRWPGFYILQWKFHSMPACAASSLPRVDDVL 206
9 -39.700sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3  ali   12  102...................................................................LRMIEVVEDNYPETLGRLLIVRAPRVFPWTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGGESVCNVPEGGLVPKSLYMTEE----EQEHTDQLWQWSETYHSASVLRGAPHEVAVEILEGESVITWDFDILRGDVVFSLYHTKQA---------------------------------------------PRLGAREPGTRASGQLIDKGWVLGRDYSRVAPLVCREGES............... 298
10 -35.000sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SEC14L1 PE=1 SV=2  ali   11  115...................................................................LRIIEVVEANYPETLGRLLILRAPRVFPWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGECMCEVPEGGLVPKSLYRTAE----ELENEDLKLWTETIYQSASVFKGAPHEILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQP------------------------------------------------PKKDSLGAHSITSPG-------GNNVQLIDKVWQ............... 300
11 -10.400sp|Q8WW62|TMED6_HUMAN(removed signalp:1-21) Transmembrane emp24 domain-containing protein 6 OS=Homo sapiens GN=TMED6 PE=2 SV=2  ali follow..  12  13......................................................................................................................................................................................PLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFSYEVQRTVGMSHDRHVAATAHN----------------------------------------PQGFLIDTSQGVRGQFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFY 119
12 -9.800sp|Q6UXK2|ISLR2_HUMAN(removed signalp:1-18) Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens GN=ISLR2 PE=2 SV=1  ali   78....................................................................................................................................................................................PGTPLRAGLAFVLHCIADHPTPRLQWQLQIPGGTVVLEPPVLSGEDDGVGAEEGEGEGDGDLLTQTQAQTPTPAPAWPAPPATPRFLALANGSLLVPLLSAKEA--------------GVYTCRAHNELG---ANSTSIRVAVAA 206
13 -9.050sp|Q8NHP6|MSPD2_HUMAN Motile sperm domain-containing protein 2 OS=Homo sapiens GN=MOSPD2 PE=1 SV=1  ali follow..  165...................................................................RFIINCFKVYYPKYLSKIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNE----VQDYVSVEYLPPHMGGTDPKYSYPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTESTSKAEENEKVDSKV-----------------------------------------------KAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIVAFKVKYRVKPSN 378

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Godzik A. Surface map comparison: studying function diversity of homologous proteins. J Mol Biol. 2001 Jun 8;309(3):793-806.