current user: public

If you have questions about the server, please let us know.

Query: sp|Q6PUV4|CPLX2_HUMAN Complexin-2 OS=Homo sapiens GN=CPLX2 PE=1 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKKLast
1 -95.500sp|Q6PUV4|CPLX2_HUMAN Complexin-2 OS=Homo sapiens GN=CPLX2 PE=1 SV=2  ali  100  1MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK 134
2 -83.300sp|O14810|CPLX1_HUMAN Complexin-1 OS=Homo sapiens GN=CPLX1 PE=1 SV=1  ali follow..  84  1MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK 134
3 -20.000sp|Q7Z7G2|CPLX4_HUMAN Complexin-4 OS=Homo sapiens GN=CPLX4 PE=2 SV=1  ali follow..  27  1MAFLMKSMISNQVKNLGFGGGSEENKEEGTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMA-----GDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKE 140
4 -19.600sp|Q8WVH0|CPLX3_HUMAN Complexin-3 OS=Homo sapiens GN=CPLX3 PE=2 SV=1  ali follow..  32  1MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKEEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQM-----AGGDVELPRELAKMIEEDTEEEEEKASVLGQLASL.......... 129
5 -11.200sp|P53801|PTTG_HUMAN(removed signalp:1-32) Pituitary tumor-transforming gene 1 protein-interacting protein OS=Homo sapiens GN=PTTG1IP PE=1 SV=1  ali follow..  31  93.............................RSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEEN......................................................... 140
6 -7.750sp|Q92576|PHF3_HUMAN PHD finger protein 3 OS=Homo sapiens GN=PHF3 PE=1 SV=3  ali   22  256......................QQQLDRPFNRGKGDRQRFYSDSHHLKRERHEK-EWEQESERHRRRD.................................................................. 300
7 -7.670sp|Q9UPN4|AZI1_HUMAN 5-azacytidine-induced protein 1 OS=Homo sapiens GN=AZI1 PE=1 SV=3  ali   13  142..............RLEHLLQAKREEQRQRSGEGTLLDLHQQKEAARRKAREEKARQARRAAIQELQQKRALRAQKASTAERGPPENPRETRVPGMRQPAQE................................ 229
8 -7.500sp|Q6ZSZ5|ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens GN=ARHGEF18 PE=1 SV=3  ali   22  1.......................QEREGEARQLRERLEQERAELERQRQAYQHDLERLREAQRAVERERERLELLRR......................................................... 54
9 -7.340sp|O00559|RCAS1_HUMAN(removed signalp:1-20) Receptor-binding cancer antigen expressed on SiSo cells OS=Homo sapiens GN=EBAG9 PE=1 SV=1  ali follow..  21  127..........GDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVK........................................................... 191
10 -7.270sp|Q8WUI4|HDAC7_HUMAN Histone deacetylase 7 OS=Homo sapiens GN=HDAC7 PE=1 SV=2  ali   12  1MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLH-KDKSKRSAVASSVVKQKLAEVILKKQQAALE............................... 102

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.