current user: public

If you have questions about the server, please let us know.

Query: sp|Q6UXR6|YI004_HUMAN(removed signalp:1-29) Putative uncharacterized protein UNQ6494/PRO21346 OS=Homo sapiens GN=UNQ6494/PRO21346 PE=5 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst FNVLIPKRDEDGDGEGPGDVTAGVSRAAGSPSGWEAPWVQQPRCCRRATPVCCAGQGPPRSLQQGGSEVLLGQLCSPEPDWLPSSGPKVAKQVFQVAAELLQHPEHFVPSSVPEGCVHKPGSTCDGSLKGRAYPSCVPKRDPEHSREESHPLSGLast
1 -125.000sp|Q6UXR6|YI004_HUMAN(removed signalp:1-29) Putative uncharacterized protein UNQ6494/PRO21346 OS=Homo sapiens GN=UNQ6494/PRO21346 PE=5 SV=1  ali  100  1FNVLIPKRDEDGDGEGPGDVTAGVSRAAGSPSGWEAPWVQQPRCCRRATPVCCAGQGPPRSLQQGGSEVLLGQLCSPEPDWLPSSGPKVAKQVFQVAAELLQHPEHFVPSSVPEGCVHKPGSTCDGSLKGRAYPSCVPKRDPEHSREESHPLSG 154
2 -7.710sp|P49589|SYCC_HUMAN Cysteinyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=CARS PE=1 SV=3  ali   19  9........DRLSEKRSPNDFALWKASKPGEPS-WPCPWGKRPGWHIECSAMAGTLLGASMDIHGGGFDLRF---------------PHHDNELAQ--SEAYFENDCWVRYFLHTGHLTIAGCKMSKSLKN-TIKDALKKHSARQLR........ 130
3 -7.260sp|Q7Z6K2|TPISL_HUMAN Putative triosephosphate isomerase-like protein LOC286016 OS=Homo sapiens PE=1 SV=2  ali follow..  15  69.........KVTNGAFTGEISPGMVKDLG------VTWVVKVAHALAEGVIACIGEKLDEREAGITEKVVFEQTLAYDPVWATGTGKTATPQQAQEVHKKLRG---WLKSNISDAVAQSTGIIYGGSVTKATCKELASQPDVA........... 209
4 -7.230sp|Q9H606|YY001_HUMAN Putative uncharacterized protein FLJ22714 OS=Homo sapiens PE=2 SV=1  ali follow..  31  4............................RSPSGLKSPRVSQGRKPRDPESLCCLGSEPHN----------LSSLLSPE-----AGQEPLPKLLPQPLAGHAAWGIHGVPTSL--------AGECWG--QGMAVPADPPPASPYRTSPRPPP... 107
5 -7.160sp|P49589|SYCC_HUMAN Cysteinyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=CARS PE=1 SV=3  ali   19  157......SADRLSEKRSPNDFALWKASKPGEPS-WPCPWGKRPGWHIECSAMAGTLLGASMDIHGGGFDLRF---------------PHHDNELAQ--SEAYFENDCWVRYFLHTGHLTIAGCKMSKSLKN-TIKDALKKHSARQLR........ 280
6 -6.920sp|Q8NAN2|FA73A_HUMAN Protein FAM73A OS=Homo sapiens GN=FAM73A PE=2 SV=1  ali   18  214.................GKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQVILSESANRIFLAESGRKILSALIVKARKN------PKKFEDVFDEMIYFLEQTDHWGST............................................ 300
7 -6.710sp|P04275|VWF_HUMAN(removed signalp:1-22) von Willebrand factor OS=Homo sapiens GN=VWF PE=1 SV=4  ali   16  214.......................................HEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQWASPEN---------------LINECVRVKEEVFIQQRNVSCPQLEVPVCPGFQLSCKTSACCP................ 300
8 -6.620sp|Q96QK1|VPS35_HUMAN Vacuolar protein sorting-associated protein 35 OS=Homo sapiens GN=VPS35 PE=1 SV=2  ali   16  10...ILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGTNLVRLSQLEGVNVERYKQI-TGILEQVVNCRDALAQ--EYLMECIIQ......................................... 118
9 -6.330sp|O75610|LFTY1_HUMAN(removed signalp:1-21) Left-right determination factor 1 OS=Homo sapiens GN=LEFTY1 PE=2 SV=1  ali follow..  18  255................................KWAENWVLEPP-----LAYECVGTCRPPEALAFKWPFLGPRQCIASE----------TDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGAVPRRLQP.................... 345
10 -6.310sp|Q8WTV1|THAP3_HUMAN THAP domain-containing protein 3 OS=Homo sapiens GN=THAP3 PE=2 SV=1  ali follow..  19  2.................................................PKSCAARQCCNRYSSRRKQLTFHRFPFSRPEWVLN----IGRGNFKPKQHTVICSEHFRPECFSAFGNRK-------NLKHNAVPTVFAFQDPTQQVREN..... 94

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.