current user: public

If you have questions about the server, please let us know.

Query: sp|Q7Z6A9|BTLA_HUMAN(removed signalp:1-30) B- and T-lymphocyte attenuator OS=Homo sapiens GN=BTLA PE=1 SV=3, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRSLast
1 -105.000sp|Q7Z6A9|BTLA_HUMAN(removed signalp:1-30) B- and T-lymphocyte attenuator OS=Homo sapiens GN=BTLA PE=1 SV=3  ali  100  1KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS 259
2 -42.800sp|Q96RD9|FCRL5_HUMAN(removed signalp:1-15) Fc receptor-like protein 5 OS=Homo sapiens GN=FCRL5 PE=1 SV=3  ali   14  1....................GDLLELHCEALRGSPLILYRFFHEDVTL-----------GNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGLTANRSGPFATGVAGGLLSIAGLAAGALLLYCWLS-------------RKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQPVYTN------------------------ANPRGENVVYSEVRIIQEKKSDPRHLRNKGSPIIYSEVKVAS 196
3 -40.700sp|Q96PQ1|SIG12_HUMAN(removed signalp:1-18) Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens GN=SIGLEC12 PE=1 SV=1  ali follow..  13  360....TASTTLRNGSALSVLEGQSLHLVCAVD-SNPPARLSWTWGSLTL-----------SPSQSSNLGVLELPRVHVKDEGEFTCRAQNPLGSQHISSLSLQNEYTGKMRPISGVTLFGGAGATALVFLYFCIIFVVVRSC--------RKKSARPAVGVGDTGMEDANAVRGSASQGPLIESPAD------------------DSPPHHAPPALATPSPEEGEIQYASLSFH--KARPQYPQEQEAIGYEYSEINIPK 577
4 -40.500sp|Q9NT99|LRC4B_HUMAN(removed signalp:1-36) Leucine-rich repeat-containing protein 4B OS=Homo sapiens GN=LRRC4B PE=1 SV=3  ali   13  24..TCYAPVIVEPPTDLNVTEGMAAELKCRT--GTSMTSVNWLTPNGTLMTHGSYRVRISV----LHDGTLNFTNVTVQDTGQYTCMVTNSAGNTTA-SATLNVSADPVAAGGTGSGGGGPGGSGGVGGGSGGYTYFTTVT-------VETLETQPGEEALQPRGTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPTVPITDVTENALKDLDDVMKTTKIIIGCFVAQLHKHHGPTRTVEIINVEDELPAASAVSVAA 298
5 -40.500sp|Q6WRI0|IGS10_HUMAN(removed signalp:1-28) Immunoglobulin superfamily member 10 OS=Homo sapiens GN=IGSF10 PE=1 SV=1  ali   11  3....KPVILTYAPGTVKGISGESLSLHCVSD-GIPKPNIKWTMPSGYVVDRPQINGKYILHDN----GTLVIKEATAYDRGNYICKAQNSVGHTLITVPVMIVAYPPRITNRPRSIVTRTGAAFQLHCVALGVPKPEITWEMP-LLSTASKERTHGSEQLHLQGTLVIQNPQTSDSGIYKCTAKNPLGSDYAA.................................................................. 189
6 -40.300sp|Q9P2V4|LRIT1_HUMAN(removed signalp:1-21) Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 OS=Homo sapiens GN=LRIT1 PE=1 SV=1  ali   13  78.RKCQGPELHPGVASIRSLLGGTALLRCGAT-GVPGPEMSWRRANGRPLNGTVHQEVS---SDGTSWTLLGLPAVSHLDSGDYICQAKNFLGASET-VISLIVTEPPTSTEHSGGGEAAAYNNKLVARHVPQIPKPAVLATGPS---VPSTKEELTLEHFQMDALGELSDGRAGPSEARMVRSVKVVGDTYHSVSL--------------VWKAPQAKNTTAFSVLYAVFGQHSM........................ 300
7 -39.500sp|P11912|CD79A_HUMAN(removed signalp:1-32) B-cell antigen receptor complex-associated protein alpha chain OS=Homo sapiens GN=CD79A PE=1 SV=2  ali follow..  17  3........MHKVPASLMVSLGEDAHFQCPHN-SSNNANVTWWRVLHGNYTWPPEFLGPGEDP----NGTLIIQNVNKSHGGIYVCRVQEGNESQQSCGTYLRVRQPPPGEGTKNRIITAEGIILLFCAVVPGTLLLFRKR....................................................................................................................... 136
8 -39.400sp|O14511|NRG2_HUMAN Pro-neuregulin-2, membrane-bound isoform OS=Homo sapiens GN=NRG2 PE=2 SV=1  ali   14  81.TDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKEL---NRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTV-RGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQR---LEKLPLRLYMPDPKQKAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQRKQMHNHLRQ....................................... 293
9 -39.200sp|Q9BTN0|LRFN3_HUMAN(removed signalp:1-16) Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Homo sapiens GN=LRFN3 PE=1 SV=1  ali   12  126..VCEPPVVTHRSPPLAVPAGRPAALRCRAV-GDPEPRVRWVSPQGRLLGNSSRARAF-------PNGTLELLVTEPGDGGIFTCIAANAAGEATAAELTVGPPPPPQLANSTSCDPPRDGDPDALTPPSAASASAKVADTGPPTDRGVQVTEHGATAALVQWPDQRPIPGIRMYQIQYNSSAD........................................................................... 300
10 -39.000sp|P30530|UFO_HUMAN(removed signalp:1-32) Tyrosine-protein kinase receptor UFO OS=Homo sapiens GN=AXL PE=1 SV=3  ali   10  1....EESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPPVDLLW---------LQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTEPGLSGIYPLTHCTLQAVLSNDGMGIQAGEPDPPEEPLTSQASV 257
11 -38.900sp|O15389|SIGL5_HUMAN(removed signalp:1-16) Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens GN=SIGLEC5 PE=1 SV=1  ali follow..  12  230....IALEILQNTSYLPVLEGQALRLLCDAP-SNPPAHLSWFQGSPAL-----------NATPISNTGILELRRVRSAEEGGFTCRAQHPLGFL-QIFLNLSVYSLPQLL---GPSCSWEAEGLHCRCSFRARPAPSLCWRLEEKPLEGNSSQGSFKVNSSSANSSLILHGGLSSDLKVSCKAWNIYGSQSGSVLLSRKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEM-KSREPKDQEAPSTTEYSEIKTSK 535
12 -38.600sp|Q9HBW1|LRRC4_HUMAN(removed signalp:1-40) Leucine-rich repeat-containing protein 4 OS=Homo sapiens GN=LRRC4 PE=1 SV=2  ali   14  10...CSAPFIMDAPRDLNISEGRMAELKCRTP---PMSSVKWLLPNGTVLSHASRHPRISV----LNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNA-SAYLNVSTAELNTSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLRKRHQQRSTVTAARTVEIIQVDE---DIPAATSAAATAAPSGVSGEGA......... 255
13 -38.500sp|Q06418|TYRO3_HUMAN(removed signalp:1-40) Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens GN=TYRO3 PE=1 SV=1  ali   13  1....AGLKLMGAPVKLTVSQGQPVKLNCSVE-GMEEPDIQWVKDGAVV---QNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPPVTIVWWRG-----------TTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKG----------------LASSRTATVHLQALPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCT-VQVTQ 224
14 -38.500sp|Q96P31|FCRL3_HUMAN(removed signalp:1-17) Fc receptor-like protein 3 OS=Homo sapiens GN=FCRL3 PE=1 SV=1  ali   12  7....SRPVLTLRAPGAQAVVGDLLELHCESLRGSFPILYWFYHEDDTL-----------NISAHSGGGASFNLSLTTEHSGNYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGI-TGLVLSILVLAAAAALLHYARARRKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGERAHEEDDEENYENV.... 258
15 -38.400sp|Q96JA1|LRIG1_HUMAN(removed signalp:1-34) Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens GN=LRIG1 PE=1 SV=2  ali   14  9....LKPQIITQPETTMAMVGKDIRFTCSAA-SSSSSTFAWKKDNEVLTNADMENFVHVHAQDGEYTTILHLRQVTFGHEGRYQCVITNHFGSTYSHKARLTVNVLPSFTKTPHDITIRTTTMARLECAATGHPNPQIAWQKDGGTDFPAARERRMHVM-PDDDVFFITDVKIDDAGVYSCTAQNSAGSISANATLTVVPLEDRVVSVGETVALQCKATGNPPPRITWFKGDRPLSLTERHQNVVAEDAGRYTCE-MSN 283
16 -38.400sp|Q8TDY8|IGDC4_HUMAN(removed signalp:1-24) Immunoglobulin superfamily DCC subclass member 4 OS=Homo sapiens GN=IGDCC4 PE=2 SV=1  ali   10  10....VELSCGVGPLQVILGPEQAAVLNCSLAAAGPPTRVTWSKDGDTLLEHLPNGSLWLSQPLAPNGSDESVPEAVGVIEGNYSCLAHGPLGVLASQTAVVKLATLADFSLHPESQTVEENGTARFECHIEGLPAPIITWEKDQVTL-----PEEPRLIVLPNGVLQILDVQESDAGPYRCVATNSARQHFSQEAL-VAAPENTTVVSGQSVVMECVASADPTPFVSWVRQDGKPISTDVIANAQPWHSGVYVCRANKP 293
17 -38.300sp|O94898|LRIG2_HUMAN(removed signalp:1-40) Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=1 SV=3  ali   12  6....LKPQIRTHPETIIALRGMNVTLTCTAVSSDSPMSTVWRKDSEILYDVDTENFVRYWQQAGEYTSILHLFNVNFTDEGKYQCIVTNHFGSNYSQKAKLTVNEMPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVM-PEDDVFFIANVKIEDMGIYSCMAQNTAGGLSANASLTIRPLEDKTVTRGETAVLQCIAGGSPAPRLNWTKDDGPLLVTERHVDAGLEDAGKYTCIMSNT 281
18 -38.200sp|Q7Z553|MDGA2_HUMAN(removed signalp:1-25) MAM domain-containing glycosylphosphatidylinositol anchor protein 2 OS=Homo sapiens GN=MDGA2 PE=2 SV=2  ali   12  14....NIEEERYSERVYTIREGETLELTCLVT-GHPRPQIRWTKTAGSASDRFQDSSVF--------NETLRITNIQRHQGGRYYCKAENGLGSPAIKSIRVDVYYLDHQSIGEAKEQFYYERTVFLRCVANSNPPVRYSWRRGQEVLLQGSDKGEPFFTQGETKILKLKNLRPQDYANYSCIASVRNVCNIPDKMVSLLVDDPIVVNPGEAITLVCVTTGGEPALTWVRSFGTLPEKTVLNPAITSDDAGTYSCI-ANN 289
19 -38.200sp|Q6UXM1|LRIG3_HUMAN(removed signalp:1-24) Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens GN=LRIG3 PE=2 SV=1  ali   12  23....PKPQITVQPETQSAIKGSNLSFICSAASSDSPMTFAWKKDNELLHDAEMENYAHLRAQGGEYTTILRLREVEFASEGKYQCVISNHFGSSYSVKAKLTVNMLPSFTKTPMDLTIRAGAMARLECAAVGHPAPQIAWQKDGGTDFPAARERRMHVM-PEDDVFFIVDVKIEDIGVYSCTAQNSAGSISANATLTLRPLLDRTVTKGETAVLQCIAGGSPPPKLNWTKDDSPLVVTERHVDSDVSDAGKYTCE-MSN 297
20 -38.100sp|O15146|MUSK_HUMAN(removed signalp:1-21) Muscle, skeletal receptor tyrosine-protein kinase OS=Homo sapiens GN=MUSK PE=1 SV=1  ali   10  1EKLPKAPVITTPLETVDALVEEVATFMCAVE-SYPQPEISWTRNKILIKLFDTRYSIR------ENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKG-----DSPLRENSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKVVK-LRAPESHNVTFGSFVTLHCTATGIPVPTITWIENGNAVSSGSIQLQLFITKPGLYTCIATNK 266
21 -37.800sp|Q02297|NRG1_HUMAN Pro-neuregulin-1, membrane-bound isoform OS=Homo sapiens GN=NRG1 PE=1 SV=3  ali   34....ALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPG--KSELRINKASLADSGEYMCKVISKLGNDSA-SANITIVESNEMPASTEGAYVSSESPIRISVSTEGANTSSSTSTST----SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARNQEKAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSEANGPHH....... 298
22 -37.800sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=2  ali   13  30....EPPTFIRELKPVEVVKYSDVELECEVT-GTPPFEVTWLKNNREIRSSKK-----YTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSC-STRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVY---SFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPASVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRY-QSVMKQDSGQYTFK-VEN 294
23 -37.800sp|P35968|VGFR2_HUMAN(removed signalp:1-21) Vascular endothelial growth factor receptor 2 OS=Homo sapiens GN=KDR PE=1 SV=2  ali   44....VAPTITGNLENQTTSIGESIEVSCTAS-GNPPPQIMWFKDNETLVEDSGIVLKD-------GNRNLTIRRVRKEDEGLYTCQACSVLGCA-KVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNVIVEFCKF.... 300
24 -37.800sp|Q13332|PTPRS_HUMAN(removed signalp:1-29) Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens GN=PTPRS PE=1 SV=3  ali   13  2....EPPRFIKEPKDQIGVSGGVASFVCQAT-GDPKPRVTWNKKGK----KVNSQRFETIEFDESAGAVLRIQPLRTRDENVYECVAQNSVGEITV-HAKLTVLRFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASRSETFESTPIRGALQIESSEETDQGKYECVATNSAGVRYSSPAN-SILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDD-ELTDVKDSANYAQITVK. 300
25 -37.700sp|P13591|NCAM1_HUMAN(removed signalp:1-19) Neural cell adhesion molecule 1 OS=Homo sapiens GN=NCAM1 PE=1 SV=3  ali   13  3........VDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDS--SSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIKNDEAEYICIAENK 273
26 -37.700sp|Q6UWL6|KIRR2_HUMAN(removed signalp:1-20) Kin of IRRE-like protein 2 OS=Homo sapiens GN=KIRREL2 PE=1 SV=2  ali   11  2....PSPHFLQQPEDLVVLLGEEARLPCAL--GAYWGLVQWTKSGLALGGQPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGPSVSLVAGVPANLTCRSRARPTPELLWFRDLDGATFHQTLLKEGTPGSVESTLTLTPFSHDDGATFVCRARSQALPTGRDTAITTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPGPRLEVVADASFLTEPVSCEVSNA 276
27 -37.700sp|Q92626|PXDN_HUMAN(removed signalp:1-26) Peroxidasin homolog OS=Homo sapiens GN=PXDN PE=1 SV=2  ali   10  14....ARPTFVIQPQNTEVLVGESVTLECSAT-GHPPPRISWTRGDRTPLPVDPRVNIT-------PSGGLYIQNVVQGDSGEYACSATNNIDSV-HATAFIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKG-----GSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTASIPSDTTVEVGANVQLPCSSQGEPEPAITWNKDGVQVTESGK-NDVGPADAGRYECVARNT 273
28 -37.700sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=2  ali   11  33....APPVFTQKPSPVGALKGSDVILQCEIS-GTPPFEVVWVK-DRKQVRNSKKFKITSKHFD----TSLHILNLEASDVGEYHCKATNEVGSDTC-SCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIAT-LQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSK-PCAEMSDKGLYSFEVKNS 299
29 -37.700sp|Q3SXY7|LRIT3_HUMAN Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 OS=Homo sapiens GN=LRIT3 PE=2 SV=2  ali   13  54.EHCLKPSVMTSATKIMSALGSNVLLRCDAT-GFPTPQITWTRSDSSP---VNYTVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEA-VVTVTVLGITTTPI-PPDTSERTGDHPEWDVQPGSGRSTSVSS----------ASSYLWSSSFSPTSSFSASTLSPPSTASFSLSPFSSSTVSSTTTLSTSANKRSFQLHQGGKRNLKVAKNGSKLPPASTSKKEELALLDQTMLT---ETNAAIENLRVVS 299
30 -37.700sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=2  ali   14  13....PPSFVKKVDPSYLMLPGESARLHCKLK-GSPVIQVTWFK-NNKELSESNTVRMYFVN----SEAILDITDVKVEDSGSYSCEAVNDVGSDSC-STEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYR---FSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGK-PDVQISFGGKYTCLAENE 278
31 -37.700sp|Q96RW7|HMCN1_HUMAN(removed signalp:1-21) Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2  ali   10  31....VPPSIAPGPTNMTVIVNVQTTLACEAT-GIPKPSINWRKNGHLLNVDQNQNSYRLLSS-----GSLVIISPSVDDTATYECTVTNGAGDDKR-TVDLTVQVPPSIADEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGIRLLPR----GDGYRILSSGAIEILATQLNHAGRYTCVARNAAGSAHRHVTLHVHEPPVLHVILNNPILLPCEATGTPSPFITWQKEGINVNTSGRNSRAVREDAGTYMCV-AQN 291
32 -37.600sp|Q96NI6|LRFN5_HUMAN(removed signalp:1-17) Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Homo sapiens GN=LRFN5 PE=1 SV=2  ali   12  116..LCEPPLITRHTHEMRVLEGQRATLRCKAR-GDPEPAIHWISPEGKLISNATRSLVY-------DNGTLDILITTVKDTGAFTCIASNPAGEA-TQIVDLHIIKLPHLLNSTNHHEPDPGSSDISTSTKSGSNTSSSNGDT------KLSQDKIVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPT.......................................................... 300
33 -37.500sp|Q6PJG9|LRFN4_HUMAN(removed signalp:1-16) Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Homo sapiens GN=LRFN4 PE=1 SV=1  ali   12  111..SCEPPLIARHTQRLWVLEGQRATLRCRAL-GDPAPTMHWVGPDDRLVGNSSRARAF-------PNGTLEIGVTGAGDAGGYTCIATNPAGEA-TARVELRVLALPHGGNSPSDIAASARTAAEGEGTLESEPAVQVTEVTATSGLV---SWGPGRPADPVWMFQIQYNSSEDETLIYRIVPASSHHFLLKHLV................................................................ 299
34 -37.500sp|Q8IWK6|GP125_HUMAN(removed signalp:1-36) Probable G-protein coupled receptor 125 OS=Homo sapiens GN=GPR125 PE=1 SV=2  ali   55....LPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRIVETDESFVEKNMIHNCSLIASALTISNIQAGSTGNWGCHVQTKRGNN-TRTVDIVVLESSAQYCPPERVRTLAGITAYLQCTRNTHGSGIYPGNPQDERKAWRRDYSRCQYANDVTRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKE.................................... 295
35 -37.400sp|Q96MS0|ROBO3_HUMAN(removed signalp:1-20) Roundabout homolog 3 OS=Homo sapiens GN=ROBO3 PE=1 SV=2  ali   10  25....VPPQLVTQPQDQMAAPGESVAFQCETK-GNPPPAIFWQKEGSQVLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAGYYVCQAVSVAGSILA-KALLEIKGPPVILQGPANQTLVLGSSVWLPCRVTGNPQPSVRWKKDGQWL----QGDDLQFKTMANGTLYIANVQEMDMGFYSCVAKSSTGEATWSGWLKMREDWGVSPDPPTEPSSPPEITKNSITLTWKP-QTGAAVTSYVIEAFSPAAGNTWRTVADGV 289
36 -37.400sp|Q96RW7|HMCN1_HUMAN(removed signalp:1-21) Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2  ali   12  7....QRGLSQDKPVEISVLAGEEVTLPCEVK-SLPPPIITWAKETQLISPFSPRHTFL-------PSGSMKITETRTSDSGMYLCVATNIAGNV-TQAVKLNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLPVITWSKGGSTMLVD----GEHHVSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQEPPTQERVANQRIEFPCPAKGTPKPTIKWLHNGRELTGREPGASVTPYDNGEYICVAVNE 272
37 -37.400sp|Q9BZZ2|SN_HUMAN(removed signalp:1-19) Sialoadhesin OS=Homo sapiens GN=SIGLEC1 PE=1 SV=2  ali   14  13.....PPKTPTMMVFVEPEGGLRGILDCRVD-SEPLASLTLHLGSRLVASSQPQGAPAEPHLASPNALRVDIEALRPSDQGEYICSASNVLGSAST-STYFGVRALHRLHQ-FQQLLWVLGLLVGLLLLLLGL-GACYTW-------RRRRVCKQSMGENSVEMAFQKETTQLIDPDAATCETSTCA........................................................................ 186
38 -37.300sp|A1KZ92|PXDNL_HUMAN(removed signalp:1-23) Peroxidasin-like protein OS=Homo sapiens GN=PXDNL PE=2 SV=3  ali   10  5....AKPSFVIQPQDTEVLIGTSTTLECMAT-GHPHPLITWTRDNGL---------ELDGSRHVATSSGLYLQNITQRDHGRFTCHANNSHGTVQA-AANIIVQAPPQFTVTPKDQVVLEEHAVEWLCEADGNPPPVIVWTKT-----GGQLPVEGQHTVLSSGTLRIDRAAQHDQGQYECQAVSSLGVKKVSVQLTTQLPQDTSVEVGKNINISCHAQGEPQPIITWNKEGVQITESGK-YDAGFPDQGRYECVARNS 262
39 -37.300sp|P13591|NCAM1_HUMAN(removed signalp:1-19) Neural cell adhesion molecule 1 OS=Homo sapiens GN=NCAM1 PE=1 SV=3  ali   11  1..................ELEEQVTLTCEAS-GDPIPSITWRTSTRNISSEEKASWTRPEKQSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQ-SMYLEVQYAPKL-QGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDKPETTYARLAALN 271
40 -37.300sp|O15394|NCAM2_HUMAN(removed signalp:1-19) Neural cell adhesion molecule 2 OS=Homo sapiens GN=NCAM2 PE=1 SV=2  ali   11  1.........................LVCDAE-GEPIPEITWKRAVDGFTFTEGDKSLDGR-KGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGH-QKSMYLDIEYAPKFISNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSLSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEP 242
41 -37.300sp|P43146|DCC_HUMAN(removed signalp:1-31) Netrin receptor DCC OS=Homo sapiens GN=DCC PE=1 SV=2  ali   10  7....TALRFLSEPSDAVTMRGGNVLLDCSAESDRGVPVIKWKK-DGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGSISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPG--DSRVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGNEAE-LQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKSNVTDDDSGMYTCVVTYK 284
42 -37.200sp|Q6WRI0|IGS10_HUMAN(removed signalp:1-28) Immunoglobulin superfamily member 10 OS=Homo sapiens GN=IGSF10 PE=1 SV=1  ali   14  12....APRIRQSNKTNKRIKAGDTAVLDCEVT-GDPKPKIFWLLPSNDMISFSIDRYTFHAN------GSLTINKVKLLDSGEYVCVARNPSGDDTK-MYKLDVVSKPPTNRTVIKATAVRHSKKHFDCRAEGTPSPEVMWIMPDNIFLTA-PYYGSRITVHKNGTLEIRNVRLSDSADFICVARNEGGESVLVPTFRNPFNEKIVAQLGKSTALNCSVDGNPPPEIIWILPNGTRFSNGPQSKTTREDAGKYRCA-ARN 287
43 -37.200sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=2  ali   16  17....APPRFVKKLSDISTVVGKEVQLQTTIE-GAEPISVVWFKDKGEIVRESDNIWISYSE----NIATLQFSRVEPANAGKYTCQIKNDAGMQEC-FATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYK---SFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRK-NMLEESDSGDYAPLTVRE 300
44 -37.200sp|O75121|MFA3L_HUMAN(removed signalp:1-28) Microfibrillar-associated protein 3-like OS=Homo sapiens GN=MFAP3L PE=2 SV=3  ali follow..  12  17....SVPVIIARTDHIIVKEGNSALINCSVY-GIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMDSGLLNITKVSFSDRGKYTCVASNIYGTV-NNTVTLRVIFTSGMVVCLVAFTIVMVLNITRLCMMSSHLKKTEKAINEFFRT--EGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLIMNCRTIMEEIMEVVGDRDEVYTIPNSLKRSDSPAADSDASSLHEQPQQIAIKVS. 292
45 -37.100sp|P55082|MFAP3_HUMAN(removed signalp:1-19) Microfibril-associated glycoprotein 3 OS=Homo sapiens GN=MFAP3 PE=2 SV=1  ali follow..  10  31....LSASSHSDDDVIIAKEGTSVSIECLLT-ASHYEDVHWHNSKGQQLDGRSRGGKWLVSD-----NFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKTEKAINE----RTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQSDDGSLNEQGQEIAVQVSVHL 301
46 -37.100sp|O60469|DSCAM_HUMAN(removed signalp:1-17) Down syndrome cell adhesion molecule OS=Homo sapiens GN=DSCAM PE=1 SV=2  ali   10  1EDHSSLYFVNASLQEVVFASTTGTLVPCPAA-GIPPVTLRWYLATGEEIYDVPGIRHVHPN------GTLQIFPFPPSHDNTYYCTAENPSGKIRSQDVHIKAVLREPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYITVVSWEKDTVSLVSGSRFLITSTGALYIKDVQNE-DGLYNYRCITRHRYTGETRQSNSARDGFDHRKAMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGR-ENIRPSDSGSYVCE-VSN 280
47 -37.100sp|O60469|DSCAM_HUMAN(removed signalp:1-17) Down syndrome cell adhesion molecule OS=Homo sapiens GN=DSCAM PE=1 SV=2  ali   13  56....SAPSILDGFDHRKAMAGQRVELPCKAL-GHPEPDYRWLKDNMP---------LELSGRFQKTVTGLLIENIRPSDSGSYVCEVSNRYGTA-KVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGTEDQELSWYRNGEILNPGKNVRITGINHENLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGTPFSEKVVSPAEPVSLMCNVKGTPLPTITWTLDDDPILKGGS-SQMITSEGNVVS...... 300
48 -37.100sp|Q8TD84|DSCL1_HUMAN(removed signalp:1-18) Down syndrome cell adhesion molecule-like protein 1 OS=Homo sapiens GN=DSCAML1 PE=1 SV=2  ali   15  71.....PPRFVVQPNNQDGIYGKAGVLNCSVD-GYPPPKVMWKHAKGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTDISKSMFLTVKIPAMITSHPNTTIAIKGHAKELNCTARGERPIIIRWEKGDTVIDPDRVMRTKDNGDEVVSTLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELEIREVKAR............................................ 283
49 -37.000sp|Q2VWP7|PRTG_HUMAN(removed signalp:1-35) Protogenin OS=Homo sapiens GN=PRTG PE=2 SV=1  ali   11  2....SELSFVKEPQDVTVTRKDPVVLDCQAH-GEVPIKVTWLKNGAKM---SENKRIEVLSNGSLYISEVEGRRGEQSDEGFYQCLAMNKYGAILSQKAHLALSTISAFEVQPISTEVHEGGVARFACKISSHPPAVITWEFN-----TTLPMTMDRITALPTGVLQIYDVSQRDSGNYRCIAATVAHRRKSMEAS-IAGPQNITTSLHQTVVLECMATGNPKPIISWSRLDHKSIDVFNTSDVRLQHAGVYVCRATTP 274
50 -37.000sp|Q9NYZ4|SIGL8_HUMAN(removed signalp:1-16) Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens GN=SIGLEC8 PE=2 SV=2  ali follow..  15  249.........LGNGSSLSVLEGQSLRLVCAVN-SNPPARLSWTRGSLTL-----------CPSRSSNPGLLELPRVHVRDEGEFTCRAQNAQGSQ-HISLSLSLQNEGTGTSRPQVTLAAVGGAGATALAFLSFCIIFIIV---------RSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTESWK---------------DGNPLKKPPPAVAPSSGEEGELHYATLSFHKV--KPQDPQGQEATDSEYSEIKIHK 461
51 -36.900sp|Q8TD84|DSCL1_HUMAN(removed signalp:1-18) Down syndrome cell adhesion molecule-like protein 1 OS=Homo sapiens GN=DSCAML1 PE=1 SV=2  ali   14  56....SIPTILDGFHSQEVWAGHTVELPCTAS-GYPIPAIRWLKDGRP---------LPADSRWTKRITGLTISDLRTEDSGTYICEVTNTFGSA-EATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRNTELVLPDEAISIRGLSNETLLITSAQKSHSGAYQCFATRKAQTAQDFAIIALEDGTPFSEKVVNPGEQFSLMCAAKGAPPPTVTWALDDEPIDGSHRTNQYTMSDGTTIS...... 300
52 -36.900sp|O94779|CNTN5_HUMAN(removed signalp:1-18) Contactin-5 OS=Homo sapiens GN=CNTN5 PE=1 SV=2  ali   14  26....LGNFSGRTRSAVSVREGQGVVLMCSPPPHSPEIIYSWVFNEFPSFVAEDSRRFISQET-----GNLYISKVQTSDVGSYICLVKNTVTNALSPPTPLTLREPKIEVHFPFTVTAAKGTTVKMECFALGNPVPTITWMKV------NGYIPSKARLRKSQAVLEIPNVQLDDAGIYECRAENSRGKNSFRGQLQVEKLNDTQLDSGSPLRWECKATGKPRPTYRWLKNGVPLSPQSR-HNVNQSDAGMYQCL-AEN 294
53 -36.900sp|Q8NDA2|HMCN2_HUMAN(removed signalp:1-23) Hemicentin-2 OS=Homo sapiens GN=HMCN2 PE=2 SV=2  ali   14  48....TVPTIRSGPPAVNVSVNQTALLPCQAD-GVPAPLVSWRKDRVPLDPRSPRFEIL-------PEGSLRIQPVLAQDAGHYLCLASNSAGSD-RQGRDLRVLEPPAIAPSPSNLTLTAHTPALLPCEASGSPKPLVVWWKDGQKLDFRLQQGAYRLL--PSNALLLTAPGPQDSAQFECVVSNEVGEAHRLYQVTADDQTDFTVTMMAPVVLTCHSTGIPAPTVSWSKAGAQLGARGSGYRVSPSGALEIGQALPIH 298
54 -36.900sp|Q12866|MERTK_HUMAN(removed signalp:1-23) Tyrosine-protein kinase Mer OS=Homo sapiens GN=MERTK PE=1 SV=2  ali   11  69....PPLAFKHTVGHIILSEHKGVKFNCSIS-IYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPPVNIFW----------VQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQ-----------------NIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCS-IQVKE 300
55 -36.900sp|P10586|PTPRF_HUMAN(removed signalp:1-29) Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens GN=PTPRF PE=1 SV=2  ali   12  2....SKPVFIKVPEDQTGLSGGVASFVCQAT-GEPKPRITWMKKGKKVSSQRFEVIEF----DDGAGSVLRIQPLRQRDEAIYECTATNSLGEINT-SAKLSVLEEPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPV--DPATSNGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPAN-SIPPSSQEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPLSNVVRSANYTCVAISS 274
56 -36.800sp|Q9Y6N7|ROBO1_HUMAN(removed signalp:1-24) Roundabout homolog 1 OS=Homo sapiens GN=ROBO1 PE=1 SV=1  ali   25....EPPHFVVKPRDQVVALGRTVTFQCEAT-GNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIIT-KAYLEVTDPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKD-----VLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQP-NSGATPTSYIIEAFSHASGSSWQTVAENV 290
57 -36.800sp|Q6MZW2|FSTL4_HUMAN(removed signalp:1-22) Follistatin-related protein 4 OS=Homo sapiens GN=FSTL4 PE=2 SV=3  ali   11  17....VPPVIRVYPESQAQEPGVAASLRCHAE-GIPMPRITWLKNGVDVSTQMSKQLSLLAN-----GSELHISSVRYEDTGAYTCIAKNEVGVDED-ISSLFIEDSARKTLANILSDDGIIVIHPVDCEIQRHLKPTEKIFMS------YEEICPQREKNATQPCQWVSAVNVRNRYIYVAQPALSRVLVVDIQAQDPLPAKLSYDKSHDQVWVLSWGDVHKSRPSLQVITEASTGQSQHPPTNLIINHIRFGFIFNKS 295
58 -36.800sp|Q9BX67|JAM3_HUMAN(removed signalp:1-30) Junctional adhesion molecule C OS=Homo sapiens GN=JAM3 PE=1 SV=1  ali follow..  10  2......VNLKSSNRTPVVQEFESVELSCIITSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGLGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESGHPRPHYSWYRNDVPLPTDSRRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGNYIRTDEEGDFRHK.... 275
59 -36.700sp|Q9HCK4|ROBO2_HUMAN(removed signalp:1-21) Roundabout homolog 2 OS=Homo sapiens GN=ROBO2 PE=1 SV=2  ali   13  1..............DQIVAQGRTVTFPCETK-GNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILA-KAQLEVTDPPIILQGPANQTLAVDGTALLKCKATGDPLPVISWLKE-----FTFPGRDPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDL----SDLPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYI-IEAFS 240
60 -36.700sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens GN=OBSCN PE=1 SV=3  ali   12....RPPDFEEELADCTAELGETVKLACRVT-GTPKPVISWYKDGKAVQVDPHHILIEDPD----GSCALILDSLTGVDSGQYMCFAASAAGNCST-LGKILVQVPPRFVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKDGALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECELVNRLGSARASAELRIQSPMLQAQEQCHREQEDTTLERADQEVTSVLKRLLGPKAPGPSTGDLTGPGPCPRGAPAL. 264
61 -36.700sp|Q8TDQ1|CLM1_HUMAN(removed signalp:1-17) CMRF35-like molecule 1 OS=Homo sapiens GN=CD300LF PE=1 SV=3  ali follow..  15  5.........ITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKT-GNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRMMKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPHLPGRGPEEPTEYSTIS... 271
62 -36.700sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=2  ali   13  5KELSDAPAFISQPRSQNINEGQNVLFTCEIS-GEPSPEIEWFK-NNLPISISSNVSISRSRN----VYSLEIRNASVSDSGKYTIKAKNFRGQCSA-TASLMVLPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQ-MDVQKQDGGLYVNIHIRS 299
63 -36.700sp|P17948|VGFR1_HUMAN(removed signalp:1-26) Vascular endothelial growth factor receptor 1 OS=Homo sapiens GN=FLT1 PE=1 SV=2  ali   13  5....KAFITVKQQVLETVAGKRSYRLSMKVK-AFPSPEVVWLKDGLPATEKSARYLTR--------GYSLIIKDVTEEDAGNYTILLSIKQSNVFKNTATLIVNVKPQVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWH----IESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISFYITDVPEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHKMAITKEHSITLNLT-IMN 299
64 -36.700sp|Q9NR99|MXRA5_HUMAN(removed signalp:1-26) Matrix-remodeling-associated protein 5 OS=Homo sapiens GN=MXRA5 PE=2 SV=3  ali   14  26....KPQILTKSPQTVSVTAETDTVFPCEAT-GKPKPFVTWTKVSTGALMTPNTRIQRFEVLKN---GTLVIRKVQVQDRGQYMCTASNLHGLDRMVVLSVTVQQPQILASHYQDVTVYLGDTIAMECLAKGTPAPQISWIFPDRRVWQTVSPVEGRITLHENRTLSIKEASFSDRGVYKCVASNAAGADSLAPVIHQEKLENISLPPGLSIHIHCTAKAAPPSVRWVLGDGTQIRPSQFLHGNAPKDSGRYECV-AAN 300
65 -36.700sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=2  ali   28.VKRAAPVIKRKIEPLEVALGHLAKFTCEIQ-SAPNVRFQWFKAGREIYESDK-----CSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTALTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWK---SDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKD-PLAKLKDSGTYVCT-ASN 297
66 -36.600sp|Q8NDA2|HMCN2_HUMAN(removed signalp:1-23) Hemicentin-2 OS=Homo sapiens GN=HMCN2 PE=2 SV=2  ali   12  42....DPPPQLVPAPNVTVSPGETAVLSCRVL-GEAPYNLTWVRDWRVLPASTGRVAQL-------ADLSLEISGIIPTDGGRYQCVASNANGVTRA-SVWLLVREAPQVSIHTSSQHFSQGVEVKVSCSASGYPTPHISWSRE-----SQALQEDSRIHVDAQGTLIIQGVAPEDAGNYSCQATNEVGTDQETVTLYSAVNAVVLVAVGEEAVLVCEASGVPPPRVIWYRGGLEMILAPE-PAAQERDAGTYTCRAVNE 297
67 -36.600sp|Q9P244|LRFN1_HUMAN(removed signalp:1-31) Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Homo sapiens GN=LRFN1 PE=1 SV=2  ali   117....PPLITRQAGGRALVVEGQAVSLRCRAV-GDPEPVVHWVAPDGRLLGNSSRTRVR-------GDGTLDVTITTLRDSGTFTCIASNAAGEA-TAPVEVCVVPLPLMAPPPAPLTEPGSSDIATPGRPGANDSAAERRLVAAELTSNS-RWPAQRPVPGIRMYQVQYNSSVDDSLVYRMIPSTSQ........................................................................ 295
68 -36.600sp|P98160|PGBM_HUMAN(removed signalp:1-21) Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens GN=HSPG2 PE=1 SV=4  ali   14  29....STRPIRIEPSSSHVAEGQTLDLNCVVP-GQAHAQVTWHKRGGSL-----------PARHQTHGSLLRLHQVTPADSGEYVCHVVGTSGPLEA-SVLVTIEASPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTW--------YKRGGSLPARHQVRGSRLYIFQASPADAGQYVCRASNGMEASITVTVTGRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTYQASPADSGEYVCRVLGS 291
69 -36.600sp|P23468|PTPRD_HUMAN(removed signalp:1-20) Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens GN=PTPRD PE=1 SV=2  ali   13  2....TPPRFTRTPVDQTGVSGGVASFICQAT-GDPRPKIVWNKKGK----KVSNQRFEVIEFDDGSGSVLRIQPLRPRDEAIYECVASNNVGEISV-STRLTVLRFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPAN-SIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNRQSANYTCVAMST 287
70 -36.600sp|O95971|BY55_HUMAN(removed signalp:1-26) CD160 antigen OS=Homo sapiens GN=CD160 PE=2 SV=1  ali follow..  17  2...........NITSSASQEGTRLNLICTVWHKKEEAVVFLCKDRSGDCSPEKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKV......................................................................................................................... 141
71 -36.600sp|Q92859|NEO1_HUMAN(removed signalp:1-33) Neogenin OS=Homo sapiens GN=NEO1 PE=1 SV=2  ali   11  18....TPFYFLVEPVDTLSVRGSSVILNCSAY-SEPSPKIEWKK-DGTFLNLVSDDRRQLLPDGSLFISNVVHSKHNKPDEGYYQCVATVESGTIISRTAKLIVAGLPRFTSQPEPSSVYAGNNAILNCEVNADLVPFVRWEQN-----RQPLLLDDRVIKLPSGMLVISNATEGDGGLYRCVVESGGPPKYSDEVE-LKQPSPLVRVIGQDVVLPCVASGLPTPTIKWMKNEEALDTESSESDVTEDDAGTYFCIADNG 292
72 -36.500sp|Q9BWV1|BOC_HUMAN(removed signalp:1-30) Brother of CDO OS=Homo sapiens GN=BOC PE=1 SV=1  ali   12  1.DLNEVPQVTVQPASTVQKPGGTVILGCVVE--PPRMNVTWRLNGKELNGSDDALGVLITH------GTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFLDVQHVIEVDEGNTAVIACLPESHPKAQVRYSVK-----EWLEASRGNYLIMPSGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSIIYPPEAQTIIVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTDTTSEEDSGTYRCMADNG 274
73 -36.500sp|Q8NDA2|HMCN2_HUMAN(removed signalp:1-23) Hemicentin-2 OS=Homo sapiens GN=HMCN2 PE=2 SV=2  ali   10  26....EEEARGGVTEYREIVENNPAYLYCDTN-AIPPPDLTWYREDQPLSAGDEVSVLQ-------GGRVLQIPLVRAENAGRYSCKASNEVGEDWL-HYELLVLTPPVIEELVEEVTVNASSTVSLQCPALGNPVPTISWLQNGLPFSPSPRLQ----VLEDGQVLQVSTAEVADAASYMCVAENQAGSAEKLPRIAGLDLEQVTAILNSSVSLPCDVHAHPNPEVTWYKDSQALSLGEEVGRARLSDSGMYTCEALNA 290
74 -36.500sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=2  ali   11  13.....PPSFTKKLTKMDKVLGSSIHMECKVS-GSLPISAQWFK-DGKEISTSAKYRLVCHER----SVSLEVNNLELEDTANYTCKVSNVAGDDAC-SGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCF---GLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPSKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDK-NNLSTEDSGDFICEAQNP 278
75 -36.400sp|Q86YD3|TMM25_HUMAN(removed signalp:1-26) Transmembrane protein 25 OS=Homo sapiens GN=TMEM25 PE=1 SV=1  ali follow..  1..ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQ--EASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRGRSANASVILNVQFKPEIAQAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSD-LDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPVAAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLI-SSDSNNLKLNNVRLPRENMSLPS 274

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.