current user: public

If you have questions about the server, please let us know.

Query: sp|Q8NBP5|MFSD9_HUMAN Major facilitator superfamily domain-containing protein 9 OS=Homo sapiens GN=MFSD9 PE=2 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470
# Score Template Links and tools%idFirst MELGGHWDMNSAPRLVSETAERKQEQKTGTEAEAADSGAVGARRFLLCLYLVGFLDLFGVSMVVPLLSLHVKSLGASPTVAGIVGSSYGILQLFSSTLVGCWSDVVGRRSSLLACILLSALGYLLLGAATNVFLFVLARVPAGIFKHTLSISRALLSDVVPEKERPLVIGHFNTASGVGFILGPVVGGYLTELEDGFYLTAFICFLVFILNAGLVWFFPWREAKPGSTEKGLPLRKTHVLLGRSHDTVQEAATSRRARASKKTAQPWVEVVLALRNMKNLLFSEMWDIFLVRLLMAMAVMLYYSNFVLALEERFGVRPKVTGYLISYSSMLGAVAGLALGPILRLYKHNSQALLLHSSILTCTLLLLYSLAPTMGAVVLSSTLLSFSTAIGRTCITDLQLTVGGAQASGTLIGVGQSVTAVGRIIAPLLSGVAQEVSPCGPPSLGAVLALVAIFIMSLNKRHSSGDGNSKLKSELast
1 -111.000sp|Q8NBP5|MFSD9_HUMAN Major facilitator superfamily domain-containing protein 9 OS=Homo sapiens GN=MFSD9 PE=2 SV=2  ali  100  1MELGGHWDMNSAPRLVSETAERKQEQKTGTEAEAADSGAVGARRFLLCLYLVGFLDLFGVSMVVPLLSLHVKSLGASPTVAGIVGSSYGILQLFSSTLVGCWSDVVGRRSSLLACILLSALGYLLLGAATNVFLFVLARVPAGIFKHTLSISRALLSDVVPEKERPLVIGHFNTASGVGFILGPVVGGYLTELEDGFYLTAFICFLVFILNAGLVWFFPWREAKPGSTEKGLPLRKTHVLLGRSHDTVQEAATSRRARASKKTAQPWVEVVLALRNMKNLLFSEMWDIFLVRLLMAMAVMLYYSNFVLALEERFGVRPKVTGYLISYSSMLGAVAGLALGPILRLYKHNSQALLLHSSILTCTLLLLYSLAPTMGAVVLSSTLLSFSTAIGRTCITDLQLTVGGAQASGTLIGVGQSVTAVGRIIAPLLSGVAQEVSPCGPPSLGAVLALVAIFIMSLNKRHSSGDGNSKLKSE 474
2 -89.500sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=2 SV=1  ali follow..  18  2......................GWGGGGGCTPRPPIHQQPPERRVVTVVFLGLLLDLLAFTLLLPLLPGLLESHGRAVLFGGLIGSAFSVLQFLCAPLTGATSDCLGRRPVMLLCLMGVATSYAVWATSRSFAAFLASRLIGGISKGNVSLSTAIVADLGSPLARSQGMAVIGVAFSLGFTLGPMLGASLPLEMAPWFALLFAASDLLFIFCFLPETLPLEKRAPSIA---------------------LGFRDAADLLSPLALLRFSAVARGQDPPSGDRLSSLRRLGLVYFLYLFLFSGLEYTLSFLTHQRFQFSSLQQGKMFFLIGLTMATIQGAYARRIHPG--GEVAAVKRALLLLVPAFLLIGWGRSLPVLGLGLLLYSFAAAVVVPCLSSVVAGYGSPGQKGTVMGTLRSLGALARAAGPLVAASVYWLAGAQACFTTWSGLFLLPFFLLQKLSYPAQTLKAE.... 455
3 -80.200sp|Q96BI1|S22AI_HUMAN Solute carrier family 22 member 18 OS=Homo sapiens GN=SLC22A18 PE=1 SV=3  ali follow..  20  2.....................QGARAPRDQGRSPGRMSALGRSSVILLTYVLAATELTCLFMQFSIVPYLSRKLGLDSIAFGYLQTTFGVLQLLGGPVFGRFADQRGARAALTLSFLAALALYLLLAAASSPALLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLGLCFGVGVILGSLLGGTLVS-AYGIQCPAILAALATLLGAVLSFTCIPASTKGAKTDA----------------------------QAPLPGGPRASVFDLKAIASLLRLPDVPRIFLVKVASNCPTGLFMVMFSIISMDFFQLEAAQAGYLMSFFGLLQMVTQGLVIGQLSSHFSEEV-LLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCTLNVVTDSMLIKAVSTSDTGTMLGLCASVQPLLRTLGPTVGGLLYRFGVPVFGHVQVAINTLVLLVLWRKPMPQRKDKVR..... 424
4 -78.300sp|Q5SR56|HIAL1_HUMAN Hippocampus abundant transcript-like protein 1 OS=Homo sapiens GN=HIATL1 PE=1 SV=3  ali follow..  18  1MSVEPPPELEE-KAASEPEAGAMPEKRAGAQAAGSTWLQGFGRPSVYHAAIVIFLEFFAWGLLTTPMLTVLHETQHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKPFLLGTVFFTCFPIPLMRIS--PWWYFAMISVSGVFSVTFSVIFAYVADVTQEHERSTAYGWVSATFAASLVSSPAIGAYLSA-SYGDSLVVLVATVVALLDICFILVAVPESLPEKMR-----------------------------PVSWGAQISWKQADPFASLKKVGKDSTVLLICITVFLSYLPEAGQYSSFFLYLRQVIGFGSVKIAAFIAMVGILSIVAQTAFLSILMRSLGNKNTVLL-GLGFQMLQLAWYGFGSQAWMMWAAGTVAAMS-SITFPAISALVSRNAESDQQGVAQGIITGIRGLCNGLGPALYGFIFYMFHVEPFLFGACIVLMSFLVALFIPEYSKASGVQKHSNS 464
5 -74.400sp|Q96MC6|HIAT1_HUMAN Hippocampus abundant transcript 1 protein OS=Homo sapiens GN=HIAT1 PE=2 SV=2  ali follow..  16  2..........TQGKKKKRAANRSIMLAKKIIIKDGGTPQGIGSPSVYHAVIVIFLEFFAWGLLTPTLVVLHETFKHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLLLTVFFTCAPIPLMKIS--PWWYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAIGAYLGRVYG-DSLVVVLATAIALLDICFILVAVPESLPEKMR-----------------------------PASWGAPISWEQADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKFSPESVAAFIAVLGILSIIAQTIVLSLLMRSIGNKNTILL-GLGFQILQLAWYGFGSEPWMMWAAGAVAAMS-SITFPAVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHGPPFLFGACSVLLALLVALFIPEHTNLSLRSSSWRK 463
6 -70.700sp|Q16572|VACHT_HUMAN Vesicular acetylcholine transporter OS=Homo sapiens GN=SLC18A3 PE=2 SV=2  ali follow..  12  2...........ESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHTESEDVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFAARSLQGLGSAFATSGIAMIADKYPEPERSRALGVALAFISFGSLVAPPFGGILYEFA-GKRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTP---------------------------------------HRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLAFLVDVRHVSVYGSVYAIADISYSVAYALGPIVAGHIVHLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDV 484
7 -70.600sp|Q8NHS3|MFSD8_HUMAN Major facilitator superfamily domain-containing protein 8 OS=Homo sapiens GN=MFSD8 PE=1 SV=1  ali follow..  15  2........AGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIRILYLTMFLSSVGFSVVMMSIWPYLQKIDADTSFLGWVIASYSLGQMVASPIFGLWSNYRPRKEPLIVSILISVAANCLYAYSHNKYYMLVARGLLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGFILGPVFQTCFTFLGNMYTTPVLLSAFLGILNIILILAILREHRVDDSG-----------------------------RQCKSINFEEASTDEAQVPQGNIDQVAVVAINVLFFVTLFIFALFETIITPLTMDMYAWTQEQAGIILAALGVEAVVIFLGVKLLSKKIGERAILLGGLIVVWVGFFILLPTPVIHLAQFLTSAVLIGLGYPVCNLMSYTLYSKILGPKPQGVYMGWLTASGSGARILGPMFISQVYAHWGPRWAFSLVCGIIVLTITLLGVVYKR--SVRYGRIQE 518
8 -70.500sp|Q05940|VMAT2_HUMAN(removed signalp:1-37) Synaptic vesicular amine transporter OS=Homo sapiens GN=SLC18A2 PE=1 SV=2  ali follow..  13  14IKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSVAGMGMLASVYTDDERGNVMGIALGGLAMGVLVGPPFGSVLYEF--GKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPL------------------------------------------TTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKM--GRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMD 448
9 -69.600sp|P54219|VMAT1_HUMAN Chromaffin granule amine transporter OS=Homo sapiens GN=SLC18A1 PE=2 SV=1  ali follow..  14  68.........SSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSVAGLGMLASVYTDHERGRAMGTALGGLALGLLVGAPFGSVMYEF--GKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPL------------------------------------------FMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKM--GRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKIGFPWLMVITGVINIVYAPLCYYLRSPPAKEEKLAILSQ 493
10 -69.100sp|Q6NT16|CF192_HUMAN MFS-type transporter C6orf192 OS=Homo sapiens GN=C6orf192 PE=2 SV=1  ali follow..  15  2..........EALGDLEGPRAPGGDDPAGSAGETPGWLSREQVFVLISAASVNLGSMMCYSILGPFFPKEAEKKGASNTIIGMIFGCFALFELLASLVFGNYLVHIGAKFMFVAGMFVSGGVTILFGVLDRIAMCFLVRVMDAVSFAAAMTASSSILAKAFPNNVATVLGSLETFSGLGLILGPPVGGFLYQS-FGYEVPFIVLGCVVLLMVPLNMYILPNYESDPGEHS----------------------------------------------WKLIALPKVGLIAFVINSLSSCFGFLDPTLSLFVLEKFNLPAGYVGLVFLGMALSYAISSPLFGLLSDKRPPLRKWLLVFGNLITAGCYMLLGIKSQLWLLVLILVVSGLSAGMSIIPTFPEILSCAGLSTLGLVSGLFSAMWSIGAFMGPTLGGFLYEIGFEWAAAIQGLWALISGLAMGLFYLLEYSRRKRSKSQN 440
11 -50.200sp|O43826|G6PT1_HUMAN Glucose-6-phosphate translocase OS=Homo sapiens GN=SLC37A4 PE=1 SV=1  ali follow..  12  2.................................AAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALCVVVSFLCLLLI----------------------------HNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWVLSTGYLVVFGVKTCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFGVIANESAPPNLCGTSHAIVGLMANVGGFLAGLPFSTIAKYSWSTAFWVAEVICAASTAAFFLLRNIRTKMGRVSKKAE 429
12 -48.900sp|Q9H3U5|MFSD1_HUMAN Major facilitator superfamily domain-containing protein 1 OS=Homo sapiens GN=MFSD1 PE=2 SV=2  ali follow..  15  1MEEEDEEARALLAGGPDEADRGAPAAPGALPALCDPSRLAHRLLVLLLMCFLGFGSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVGIRWGTIIFSCFVCIGQVVFALGNAFWLMEFGRFVFGIGGESLAVAQTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTTLGITLMIGGITCILSLICALALA------------------------YLDQRAERILHKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAVFPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMM---LAFTMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDLFLEVFFIACVSLSLLSVVLLYLVNRAQGGNLNYSARQR 456
13 -48.100sp|P57057|GLPT_HUMAN(removed signalp:1-38) Glycerol-3-phosphate transporter OS=Homo sapiens GN=SLC37A1 PE=1 SV=2  ali follow..  13  18............................................WDEADVRFSSQNRKSGSAAPHQLPDNETDKNNYQQLLGALDYSFLCAYAVGMYLSGIIGERLPIRYYLTFGMLASGAFTALFGLGHSFGFYVVTQVINGLVQTGWPSVVTCLGNWFGKGRRGLIMGVWNSHTSVGNILGSLIAGYWVST-CWGLSFVVPGAIVAAMGIVCFLFLIEHNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIHPNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFDVGGIFGGILAGVISDRLEKRASTCGLMLLLAAPTLYIFSTVSKMGLEAALVSGPYTLITTAVSADLGTHKSLKGNAHALSTVTAIIDGTGSVGAALGPLLAGLLSPSGWSNVFYMLMFADACALLFLIRLIHKELSCPGSATGDQ 489
14 -47.600sp|Q8NCC5|SPX3_HUMAN(removed signalp:1-36) Sugar phosphate exchanger 3 OS=Homo sapiens GN=SLC37A3 PE=2 SV=2  ali follow..  13  6......................................SNVKVSISEQWTPSAFNTSVELPVEIWSSNHLFPSAEKATLFLGTLDTIFLFSYAVGLFISGIVGDRLNLRWVLSFGMCSSALVVFVFGALTNKWLYCCLWIVNGLLQSGWPCVVAVMGNWFGKAGRGVVFGLWSACASVGNILGACLASSVLQYG---YEYAFLVTASVQFAGGIVIFFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKAISFYQACCLPGVIPYSLAYACLKLVNYSFFFWLPFYLSNNFGWKEAEADKLSIWYDVGGIIGGTLQGFISDVLQKRAPVLALSLLLAVGSLIGYSRSPNDKSINALLMTVTGFFIGGPSNMISSAISADRSSEALATVTGIVDGSGSIGAAVGQYLVSLIRDLGWMWVFYFFILMTSCTIVFISPLIVREIFSLVLRRQAH 454
15 -47.500sp|Q9UPI3|FLVC2_HUMAN Feline leukemia virus subgroup C receptor-related protein 2 OS=Homo sapiens GN=FLVCR2 PE=1 SV=1  ali follow..  10  44.SVSVHPSSSAHPSALAQPSGLAHPSSSGPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSAFAIDWLSMCYMLTYIPLLLPVAWLLEKFGLRTIALTGSALNCLGAWVKLGSHLFPVTVVGQLICSVAQVFILGMPSRIASVFGANEVSTACSVAVFGNQLGIAIGFLVPPVLVPNIEDRDELAYHISIMFYIIGGVATLLLILVIIVFK---------------------EKPKYPPSRAQSLSYALTSPDASYLGSIARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIGLTIVIAGMLGAVISGIWLDRSKTYKETTLVVYIMTLVVVYTFTLNLGHLWVVFITAGTMGFFMTGYLPLGFEFAVELTYPESEGISSGLLNISAQVFGIIFTISQGQIIDYGTKPGNIFLCVFLTLGAALTAFIKADLRRQKANKETLE 502
16 -47.400sp|Q6ZMD2|SPNS3_HUMAN Protein spinster homolog 3 OS=Homo sapiens GN=SPNS3 PE=2 SV=2  ali follow..  15  4.GMSAECPEPGPGGLQGQSPGPGRQCPPPITPTSWSLPPWRAYVAAAVLCYINLLNYMNWFIIAGVLLDIQEVFQISDNHAGLLQTVFVSCLLLSAPVFGYLGDRHSRKATMSFGILLWSGAGLSSSFISPSWLFFLSRGIVGTGSASSTIAPTVLGDLFVRDQRTRVLAVFYIFIPVGSGLGYVLGSAVTMLTGNWRWALRVMPCLEAVALILLILLVPDPPRGAAETQGEGAVGGFRSSWCEDVR------------------------------YLGKNWSFVWSTLGVTAMAFVTGALGFWAPKFLLEARVVHGLQPGALTIMTGVIGVILGAEAARRYKKVIPGAEPLICASSLLATAPCLYLALPTTLLASYVFLGLGELLLSCNWAVVADILLSVVVPRCRGTAEALQITVGHIGDAGSPYLTGLISSVSLQQSFLCCAFVIALGGGCFLLTALYLERDETRAWQP. 481
17 -47.200sp|Q96NT5|PCFT_HUMAN Proton-coupled folate transporter OS=Homo sapiens GN=SLC46A1 PE=1 SV=1  ali follow..  14  2.........................EGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWH-TLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLASLGLLLQALVSVFVVHVGYFVLGRILCALLGDFGGLSFASVADVSSSRSRTFRMALLEASIGVAGMLASLLGGHWLR-AQGYANPFWLALALLIAMTLYAAFCFGETLKEPKSTRLFTFRHHRSIVQLYVAPAPEKSR-----------------------------KHLALYSLAIFVVITVHFGAQDILTLYELSTPLCWDSKLIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEI-GLAFNILGMVVFAFATITPLMFTGYGLLFLS-LVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNFPFLLGAGLLLIPAVLIGMLEKADPHLEFQQFPQS 458
18 -46.800sp|Q9Y5Y0|FLVC1_HUMAN Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens GN=FLVCR1 PE=1 SV=1  ali follow..  10  67.PQTPLAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRRFVVLLIFSLYSLVNAFQWIQYSIISNVFEGFYGVTLLHIDWLSMVYMLAYVPLIFPATWLLDTRGLRLTALLGSGLNCLGAWIKCGSHLFWVTMLGQCLCSVAQVFILGLPSRIASVFGPKEVSTACATAVLGNQLGTAVGFLLPPVLVPNTQNDTNLLACNISTMFYGTSAVATL--------------------LFILTAIAFKEKPRYPPSQAQAALQDSPPEEYSYKKSIRNLFKNIPFVLLLITYGIMTGAFYSVSTLLNQMILTYYEGEEVNAGRIGLTLVVAGMVGSILCGLWLDYTKTYKQTTLIVYILSFIVIFTFTLDLRYIIIVFVTGGVLGFFMTGYLPLGFEFAVEITYPESEGTSSGLLNASAQIFGILFTLAQGKLTSYGPKAGNIFLCVWMFIGIILTALIKSDLRRHNINIGITN 526
19 -46.100sp|Q8TED4|SPX2_HUMAN(removed signalp:1-34) Sugar phosphate exchanger 2 OS=Homo sapiens GN=SLC37A2 PE=2 SV=2  ali follow..  13  45........................................................................DKDNYKELLGGVDNAFLIAYAIGMFISGVFGERLPLRYYLSAGMLLSGLFTSLFGLGYELWYFVVIQVCNGLVQTGWPSVVTCVGNWFGKGKRGFIMGIWNSHTSVGNILGSLIAGIWVNGQWGLSFIVPGIITAVMGVITFLFLIEHPEDVDCAPPQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEFSLCLLFAKLVSYTFLYWLPLYIANVAHFSAKEAGDLSTLFDVGGIIGGIVAGLVSDYTNGRATTCCVMLILAAPMMFLYNYIGQDGIASGLVNGPYALITTAVSADLGTHKSLKGNAKALSTVTAIIDGTGSIGAALGPLLAGLISPTGWNNVFYMLISADVLACLLLCRLVYKEILAWKVSLSRG 461
20 -45.300sp|Q9H2V7|SPNS1_HUMAN Protein spinster homolog 1 OS=Homo sapiens GN=SPNS1 PE=1 SV=1  ali follow..  11  18.DGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRITGLSPGRSALIVAVLCYINLLNYMDRFTVAGVLPDIEQFFNIGDSSSGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPHFWLLLLTRGLVGVGASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDMAGDWHWALRVTPGLGVVAVLLLFLVVREPPRGAVERHSDLPPLNPTSWWADLRAL-------------------------------ARNPSFVLSSLGFTAVAFVTGSLALWAPAFLLRSRVVLSSSDSLIFGLITCLTGVLGVGLGVEISRRLRHSVCATGLLGSAPFLFLSLACARGSIVATYIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLGDAGSPYLIGLISDRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLH. 495
21 -45.200sp|Q9BY10|TSCOT_HUMAN Thymic stromal cotransporter homolog OS=Homo sapiens GN=SLC46A2 PE=2 SV=1  ali follow..  14  2............................SPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKA-RAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSRLGLLLKVPVEVLYGAAALNGLFGGFSAFVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTACSVSCASFALLYSLLVLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTTIA-----LLFVGAIIYDLAVVGTVDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCF--RDTTMIMIGMVSFGSGALLLAFVKETYMFYIARAV-MLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGVVTSTLYNKIYQLTMDSCFALSSFLSFLAIIPISIVAYKQVPLSPYGDIIE 474
22 -43.700sp|Q8IVW8|SPNS2_HUMAN Protein spinster homolog 2 OS=Homo sapiens GN=SPNS2 PE=1 SV=2  ali follow..  11  61.SGSVRRAPTGPPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRYTVAGVLLDIQQHFGVKDRGAGLLQSVFICSFMVAAPIFGYLGDRFNRKVILSCGIFFWSAVTFSSSFIPQFWLLVLSRGLVGIGEASSTIAPTIIGDLFTKNTRTLMLSVFYFAIPLGSGLGYITGSSVKQAAGDWHWALRVSPVLGMITGTLILILVPATKRGHADQLGDQLKARTSWLRDMK--------------------------------ALIRNRSYVFSSLATSAVSFATGALGMWIPLYLHRAQVVQKTAETLIFGAITCFTGFLGVVTGAGATRWCRLKVCAVGMLGSAIFICLIFVAAKSSIVGAYICIFVGETLLFSNWAITADILMYVVIPTRRATAVALQSFTSHLGDAGSPYLIGFISDLSLGYALMLCPFVVVLGGMFFLATALFFVSDRARAEQQ. 536
23 -42.300sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2  ali follow..  12  1MATKPTEPVTILSLRKLSLGTAEPQVKEPKTFTVEDAVETIHIALFLIMGSTGVVEAMEIMLIAVVSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWFVFLRTMVGCGVSGHSQGLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASIPGIIL--IVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRTTLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSMIISTIGEIALNPLNILGINFL--GRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLMSASILGALCLFSSVCVVCAISAFTLPIETKGRALQQIK.. 492
24 -42.000sp|Q7Z3Q1|S46A3_HUMAN(removed signalp:1-16) Solute carrier family 46 member 3 OS=Homo sapiens GN=SLC46A3 PE=2 SV=1  ali follow..  13  53............................................................................VSRFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCPFQLLIASTFIGAFCGNYTTFCFAYIVDQCKEKQKTIRIAIIDFLLGLVTGLTGLSSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGDPVKECSSQNVTMSCSEGFKNLFYRTYMLFKNASGKRR-------------------------FLLCLLLFTVITYFFVVIGIAPIFILYELDSLCWNEVFIGYGSALGSASFLTSFLGIWLFSYCM--EDIHMAFIGIFTTMTGMAMTAFASTTLMMFLARVPFLFT-IVPFSVLRSMLSKVVRSTEQGTLFACIAFLETLGGVTAVSTFNGIYSATVAFTFLLSAGLLLLPAISLCVVKCTSWNEGSYELLIQ 435
25 -40.900sp|Q6UXD7|MFSD7_HUMAN Major facilitator superfamily domain-containing protein 7 OS=Homo sapiens GN=MFSD7 PE=2 SV=1  ali follow..  12  2..............AGPTEAETGLAEPRALCAQRGHRTYARRWVFLLAISLLNCSNATLWLSFAPVADVIAEDLVLSMEQINWLSLVYLVVSTPFGVAAIWILDSVGLRAATILGAWLNFAGSVLVGTQNPFAFLMGGQSLCALAQSLVIFSPAKLAALFPEHQRATANMLATMSNPLGVLVANVLSPVLVKKGEDIPLMLGVYTIPAGVVCLLSTICLWESVPP--------------------------------TPPSAGAASSTSEKFLDGLKLQLMWNKAYVILAVCLGGMIGISASFSALLEQILCASGHSSGFSGLCGALFITFGILGALALGPYVDRTKHFTEATKIGLCLFSLACVPFALVSGQTLALAATCSLLGLFGFSVGPVAMELAVECSFPVGEGAATGMIFVLGQAEGILIMLAMTALTV-WTVSLLLMAGLCTFFSCILAVFFHTPYRRLQAESGEPP 457
26 -40.600sp|Q6N075|MFSD5_HUMAN(removed signalp:1-18) Major facilitator superfamily domain-containing protein 5 OS=Homo sapiens GN=MFSD5 PE=2 SV=2  ali follow..  12  2.......................ELSRCRAKPPGRACSNPSFLRFQLDFYQVYFLALAADWLQAPYLYKLYQHYYFLEGQIAILYVCGLASTVLFGLVASSLVDWLGRKNSCVLFSLTYSLCCLTK-LSQDYFVLLVGRALGGLSTALLSAFEAWYIHEHPAEWIPATFARAAFWNHVLAVVAGVAAEAVASWIGLGPVAPFVAAIPLLALAGALALRNWGENYDRQRAFSRTCAGGLRCL--------------------------------------LSDRRVLLLGTIQALFESVIFIFVFLWTPVLDP----HGAPLGIIFSSFMAASLLGSSLYRIATSKRYHLSLAVLIVVFSLFMLTFSTSPGQESPVESFIAFLLIELACGLYFPSMSFLRRKVIPETEQAGVLNWFRVPLHSLACLGLLVLHDSDRTGTRNMFSICSAVMVMALLAVVGLFTVVRHDAELRVPSP 423
27 -40.300sp|Q5TF39|NAGT1_HUMAN Sodium-dependent glucose transporter 1 OS=Homo sapiens GN=NAGLT1 PE=2 SV=1  ali follow..  10  1...............................................MLCASFLGLGLSVAIVGPTFQDLATNVNRNISSLSFIFVGRALGYLSGSVIGGFLVDVMNYFLLLGISMSATTVGLYLVPFCKTAILLTVMMSIFGVSIGILDTGGNVLILAIWGDKGAPHMQALHFSFALGAFLAPLLAKLALGPTASAENHTESDFHPALNQSSDADSEALFGVPNDKNLLWAYAVIGTYMFLVSVIFFCLFLKNSSKQEKARASAETFRR-------AKYHNALLCLLFLFFFFYVGAEVTYGSYVFSFATTHAGMKESEAAGLNSIFWGTFAACRGLAIFFATCL-QPGTMIVLSNIGSLTSSLFLVLFDKNPICLWIATSVYGASMATTFPSGVSWIEQYTTIH--GKSAAFFVIGASLGEMAIPAVIGILQGYPDLPVVLYTSLGASIATGILFPVLYKLATSPLDRQRKE 418
28 -39.800sp|Q5VZR4|HIAL2_HUMAN Hippocampus abundant transcript-like protein 2 OS=Homo sapiens GN=HIATL2 PE=2 SV=1  ali follow..  16  2..SVEPPPELEEKAASEPEAGAMPEKRAGAQAAGSTWLQGFGPPSVYHAAIVIFLEFFAWGLLTTPMLTVLHETFSQHLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKPFLLGTVFFTCFPIPLMRISPCQ...................................................................................................................................................................................................................................................................................................................................................... 133
29 -38.200sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1  ali follow..  13  85...........................................KLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCILLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLDVLSGNQEKAIATLKRIATENGAPMPLGKLIISRQEDRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCGISSRKKAVEAKCSLACEYLSMDLLWTTLSEFPGVLVTLWIIDRL--GRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYLTLAVYSGCCLLAALASCFLPIETKGRGLQESSHR 523
30 -38.100sp|O15374|MOT5_HUMAN(removed signalp:1-36) Monocarboxylate transporter 5 OS=Homo sapiens GN=SLC16A4 PE=2 SV=1  ali follow..  12  8.................................................................FFVVFQEEFEGTSEQIGWIGSIMSSLRFCAGPLVAIICDILGEKTTSILGAFVVTGGYLISSWATSIPFLCVT-LLPGLGSAFLYQVAAVVTTKYFKKRLALSTAIARSGMGLTFLLAPFT--FLIDLYDWTGALILFGAIALNLVPSSMLLRPIHIKSENNSGIKDKGSSLSAQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKT-LGIDIMDASYLVSVAGILETVSQIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT.... 451
31 -37.700sp|O60669|MOT2_HUMAN(removed signalp:1-35) Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=2 SV=2  ali follow..  13  1.....................................................FPKAVTV-----FFKEIQQIFHTTYSEIAWISSIMLAVMYAGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMFITGLGLAFNLQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLILGSLLLNACVAGSLMRPLGPNQTTSKSK----------------NKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFSLFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKD-QGIDEYSAAFLLSVMAFVDMFARPSVGLIANSKYPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFETLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEE 404
32 -37.500sp|P53985|MOT1_HUMAN(removed signalp:1-35) Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3  ali follow..  10  1.....................................................FPKSITV-----FFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVC-VIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKS-QHYSSEKSAFLLSILAFVDMVARPSMGLVANTIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMDYKYTYWACGVVLIISGIYLFIGMGINYRLLAKEQKAN 420
33 -36.700sp|Q9BYT1|S17A9_HUMAN Solute carrier family 17 member 9 OS=Homo sapiens GN=SLC17A9 PE=2 SV=2  ali follow..  14  2....................QPPPDEARRDMAGDTQWSRPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLAFMTFSRILMGLLQGYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEWYGWQSIFYFSGGLTLLWVWYVYRYL-------------------------------LSEKDLILALGVLAQSRPVSRHNRVPWRRLFRKPAVWAAVVSQLSAACSFFILLSWLPTFFEETFPDA--KGWIFNVVPWLVAIPASLFSGFLSDHLINQRKLMQGMGLGLSSVFALCLGHTSSFCESVVFASASIGLQTFNHSGISVNIQDLAP-SCAGFLFGVANTAGALAGVVGVCLGGYLME-SWTCLFNLVAIISNLGLCTFLVFGQAQRVDLSSTHED. 435
34 -36.300sp|Q9UMX9|S45A2_HUMAN Membrane-associated transporter protein OS=Homo sapiens GN=SLC45A2 PE=1 SV=2  ali follow..  13  2............GSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDRWGRRPYILTLGVMMLVGMALYLNGATV-TMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTGFGGALGYLLGAILGRLLGTEFQVMFFFSALVLTLCFTVHLCSISEAPLTEVAKGIPPQQTPQKVKNGYVNPELAMQGAKNKNHAEQTRRAMTLKSLLRALVNM--PHYRYLCISHLIGWTAFLSNMLFFTDFMFLIYERGVEVGCWGLCINSVFSSLYSYFQKVLVSYI--GLKGLYFTGYLLFGLGTGFIGLFPNVYSTLVLCSLFGVMSSTLYTVPFNLITEYHREEEKGMDCATLTCMVQLAQILVGGGLGFLVNTTVVVVVITASAVALIGCCFVALFVR............. 527
35 -35.700sp|O95907|MOT3_HUMAN(removed signalp:1-32) Monocarboxylate transporter 3 OS=Homo sapiens GN=SLC16A8 PE=2 SV=1  ali follow..  17  10.................................................................FFRALMRDFDAGYSDTAWVSSIMLAMLYGTGPVSSILVTRFGCRPVMLAGGLLASAGMILASFATRLLELYLT-VLTGLGLALNFQPSLIMLGLYFERRRPLANGLAAAGSPVFLSALSPLGQQLLERFGWRGGFLLLGGLLLHCCACGAVMRPPPGPGPRPRRDSA---------GDRAGDAPGEAEADGAGLQLREASPRVRPRRRLLDLAVCTDRAFAVYAVTKFLMALGLFVPAILLVNYAKD-AGVPDTDAAFLLSIVGFVDIVARPACGALAGLARPHVPYLFSLALLANGLTDLSSARARSYGALVAFCVAFGLSYGMVGALQFEVLMAAVGAPRFPSALGLVLLVEAAAVLIGPPSAGRLVDVNYEIIFYLAGSEVALAGVFMAVATNCCLRCAKAAPSGP 413
36 -35.600sp|O15375|MOT6_HUMAN(removed signalp:1-27) Monocarboxylate transporter 6 OS=Homo sapiens GN=SLC16A5 PE=2 SV=1  ali follow..  12  10.................................................................FFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAFITGLGMCFSFQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKE-------------------CPPPPPETPALGCLAACGRTIQRHLAFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMW-HSVDEQQAALLISIIGFSNIFLRPLAGLMAGRPASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIFQVLMDIVPMDQFPRALGLFTVLDGLAFLISPPLAGLLLDANFSYVFYMSSFFLISAALFMGGSFYALQKKEQGKQAVA 403
37 -35.300sp|Q7RTY0|MOT13_HUMAN(removed signalp:1-29) Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1  ali follow..  16  8.................................................................FFVEFVAAFEEQAARVSWIASIGIAVQQFGSPVGSALSTKFGPRPVVMTGGILAALGMLLASFATSLTHLYLSILLSGSGWALTFAPTLACLSCYFSRRRSLATGLALTGVGLSSFTFAPFFQWLLSHYAWRGSLLLVSALSLHLVACGALLRPPSLAEDPAVGG-----------------------------------------PRAQLTSLLHHGPFLRYTVALTLINTGYFIPYLHLVAHLQD-LDWDPLPAAFLLSVVAISDLVGRVVSGWLGDAVPGPVTRLLMLWTTLTGVSLALFPVAQAPTALVALAVAYGFTSGALAPLAFSVLPELIGTRRIYCGLGLLQMIESIGGLLGPPLSGYLRDVNYTASFVVAGAFLLSGSGILLTLPHFFCFSTTTSGPQD 377
38 -35.000sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=2 SV=2  ali follow..  11  20..............................................MIVAGCFLVTICTRAVTRCFFVEFQTYFTQDYAQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIMLGGLLASTGLILSSFATSLKHLYLT-VLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDHTTPEQN---------HVCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYSFLLMSDFVVLAVSVLFMAYGCSPLFVYLVPYALS-VGVSHQQAAFLMSILGVIDIIGNITFGWLTDRRCLKNYQYVCFAVGMDGLCYLCLPMLQSLPLLVPFSCTFGYFDGAYVTLIPVVTTEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGRLVDTSYTAAFLLCGFSMIFSSVLLGFARLIKRMRKTQLQFIA 445
39 -34.900sp|P41440|S19A1_HUMAN Folate transporter 1 OS=Homo sapiens GN=SLC19A1 PE=1 SV=3  ali follow..  12  3...................PSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMA--QIRPGESFITPYLLGPDKNFTREQVTNEITPVSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQLMELFYSVTMAARIAYSSYIFSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRVSFSTLNYISLAFLTFSVVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGHALRVACGDSVLARMLRELG--DSLRRPQLRLWSLWWVFNSAGYYLVVYYVHILVDPTTNSARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLVFLLAHPSSIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTI--VSDVRGLGLPVRKQFQLSVYFLILSIIYFLGAMLDGLRHCQRGHHPR 465
40 -34.800sp|Q7RTY1|MOT9_HUMAN(removed signalp:1-28) Monocarboxylate transporter 9 OS=Homo sapiens GN=SLC16A9 PE=2 SV=1  ali follow..  15  8.................................................................LYIEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLCVSSFGARPVTIFSGFMVAGGLMLSSFAPNIYFLFFS-IVVGLGCGLLYTATVTITCQYFDDRRGLALGLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQSSDCPLPKKIAPEDLTVTHTKEPETYKKKVAEQTYFCKQLAKRKWQLYKNYCGETVALFKNKVFSALFIAILLFDIGGFPPSLLMEDVARSSNVKEEEFIMPLISIIGIMTAVGKLLLGILADFKWINTLYLYVATLIIMGLALCAIPFAKSYVTLALLSGILGFLTG-NWSIFPYVTTKTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTYDIAFYFSGFCVLLGGFILLLAALPSWDTCNKQLPKP 468
41 -34.800sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=2 SV=1  ali   14  111.QPKGDEYKDRRELESERRADEEELAQQYELIIQECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAFLSSFVQGYGFFLFCRLLSGFGGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAI............................................................................................................................................................................................................................................................................................ 300
42 -34.700sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1  ali follow..  12  2.............YTSHEDIGYDFEDGPKDKKTLKPHPNIDGGWAWMMVLSSFFVHILIMGSQMALNVEWLEEFHQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFIT-VAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRPLSPGKNPNDPGEKDVRGLPAHSTESVKSTGRILKTVSWLTMRVRKGFEDWYSGYFGTASLFTNRMFVAFIFWALFAYSSFVIPFIHLPEIVNLYNLSEQNDVFPLTSIIAIVHIFGKVILGVIADLPCISVWNVFLLANFTLVLSIFILPLMHTYAGLAVICALIGFSSGYF-SLMPVVTEDLVGIEHLANAYGIIICANGISALLGPPFAGWIYDIKYDFSFYICGLLYMIGILFLLIQPCIRIIEQSRRKYMD 506
43 -34.000sp|Q8N468|MFSD4_HUMAN(removed signalp:1-33) Major facilitator superfamily domain-containing protein 4 OS=Homo sapiens GN=MFSD4 PE=2 SV=3  ali follow..  13  1.............................................................FLGPTLLDLRCQTHSSLPQISWVFFSQQLCLLLGSALGGVFKRTLAQSLWALFSSLAISLVFAVIPFCRDVKVLASVMALAGLAMGCIDTVANMQLVRMYQKDSAVFLQVLHFFVGFGALLSPLIADPFTRVSYAFWIMALINLPVPMAVLMLLSKERLLTCCPQRRPLLLSADELALETQPPEKEDASSLPPKFQSHLGHEDLFSCCQRKNLRGAPYSFFAIHITGALVLFMTDGLTGAYSAFVYSYVEKPLSVGHKVAGYLPSLF--GFITLGRLLSIPISSRMKPATMVFINVVGVVVTFLVLLIFSYNVVFLFVGTASLGLFLSSTFPSMLAYTEDSLQYK--GCATTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLAFTFYILLLFFHRMHPGLPSVP 465
44 -34.000sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2  ali follow..  13  2......................TQNKLKLCSKANVYTEVPDGGWGWAVAVSFFFVEVFTYGIIKTFFNDLMDSFNESNSRISWIISICVFVLTFSAPLATVLSNRFGHRLVVMLGGLLVSTGMVAASFSQEVSHMYVA-IISGLGYCFSFLPTVTILSQYFGKRRSIVTAVASTGECFAVFAFAPAIMALKERIGWRYSLLFVGLLQLNIVIFGALLRPIFIRGPASPKIVIQENRKEAKNVPTHTNLELEPKADMQQVLVKTSPRPSEKKAPLLDFSILKEKSFICYALFGLFATLGFFAPSLYIIPLGIS-LGIDQDRAAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLADVVGIEKMSSAAGVYIFIQSIAGLAGPPLAGLLVDQIYSRAFYSCAAGMALAAVCLALVRPCKMGLCQHHHSGE 486
45 -33.400sp|Q6ZSS7|MFSD6_HUMAN Major facilitator superfamily domain-containing protein 6 OS=Homo sapiens GN=MFSD6 PE=1 SV=2  ali   15  24.DPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILPTNSSFTSFLTISPKMREKRNL........................................................................................................................................................................................................................................................................................................ 201
46 -33.100sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1  ali follow..  12  27.AAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHEPPEPPEGGWGWLVMLAAMWCNGSVFGIQNALFVSMLETFDKMVFKTAWVGSLSMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYIIFACGCSFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIFMFVLFLAGFTYRPLA--------------------------TSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGIPLALFGYFVPYVHLMKHVNE-RFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVYLVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAIGFLLGFMSIPMTVGPPIAGLLRDKSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREISKTT 484
47 -33.000sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=2 SV=1  ali   15  3...........................................ALFFVLGMALMADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAFLSSFVQGYGFFLFCRLLSGFGGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGWSWRVFVIVCALPCVSSVVALTFMPESPR.......................................................................................................................................................................................................................................................... 195
48 -32.400sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2  ali follow..  14  2.......................ENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKLMLLLWSCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAILMGVSKAFELIVFSRVVLGVCAGSYSALPMYLGELAPKNLRGMVGTMTEVFVIVGVFLAQIFSQAILGNPAGWPVLLALTGVPALLQLLTLPFFPESPRYSLIQKGDEATARQALRRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSL--RWQLLSIIVLMAGQQLSGINAINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVMTITSAVLVERLG--RRHLLLAGYGICGSACLVLTVV-GIICVFAYIAGHSIGPS---PVPSVVRTEIFLQSSRRAAFMVDGAVHWLTNFIIGFLFPSIQEAIGAYSFIIFAGICLLTAIYIYVVIPETKGKTFVEINR. 479
49 -32.400sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=2 SV=3  ali follow..  10  2.................TPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLE------WRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKP-----------FIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVV--VGVIQVLFTAVAALIMDRAG--RRLLLVLSGVVMVFSTSAFGAGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMALVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITA. 472
50 -32.400sp|Q8NCK7|MOT11_HUMAN Monocarboxylate transporter 11 OS=Homo sapiens GN=SLC16A11 PE=2 SV=1  ali follow..  13  1MPAPQRKHRRGGFSHRCFPTPQTAMTPQPAGPPDGGWG-----VVAAAAFAINGLSYGLLRSLGLAFPDLAEHFDRSAQDTAWISALALAVQQAASPVGSALSTRWGARPVVMVGGVLASLGFVFSAFASDLLHLYLGLLLAGFGWALVFAPALGTLSRYFSRRRVLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPCGALLLPLVLPGDPPAPP--------------------------------------RSPLAALGLSLFTRRAFSIFALGTALVGGGYFVPYVHLAPHALD-RGLGGYGAALVVAVAAMGDAGARLVCGWLADQGWVPLPRLLAVFGALTGLGLWVVGLESWGGPLLAAAVAYGLSAGSYAPLVFGVLPGLVGVGGVVQATGLVMMLMSLGGLLGPPLSGFLRDEDFTASFLLSGSLILSGSFIYIGLPRALPSCGPASPPAT 441
51 -32.200sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1  ali   14  17...........................................TLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAISAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPR.......................................................................................................................................................................................................................................................... 209
52 -32.100sp|Q14916|NPT1_HUMAN Sodium-dependent phosphate transport protein 1 OS=Homo sapiens GN=SLC17A1 PE=2 SV=2  ali follow..  12  19..........................................RYGLSFLVHCCNVIITAQRACLNLMVVMVNMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSVLSLLIPPAAGIAWVVVCRAVQGAAQGIVTAQFEIYVKWAPPLERGRLTSMSTSGFLLGPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVLFYDDPKDHPC------------------------SISEKEYITSSLVQQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNIMTLYTPMFINSMLHVNIKENGFLSSLPYLFAWICGNLAGQLSDFFLTRRKLFTAAGFLLPAIFGVCLPYLSSTFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLILK-AWFKTFILMAAINVTGLIFYLIVATAEIQDWAKEKQHT 465
53 -31.900sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2  ali follow..  11  13.GLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRKDWSCSLLVASLAGAFGSSFLYGYNLSVVNAPTPYIDTLTLLWSVTVSIFAIGGLVGTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSGAFEMLIVGRFIMGIDGGALSVLPMYLSEISPKEIRGSLGQVTAIFICIGVFTGQLLGPELLGKESTWPYLFGVIVVPAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPYV--RWQVVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETLAAVFSGLVIEHLG--RRPLLIGGFGLMGLFFGTLTIT-SIVGILAIIASFCSGPG---GIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQ. 512
54 -31.800sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2  ali follow..  12  57.PLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNSLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSK---------------------------RGVRTLHQRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEE-EFSEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDS 512
55 -31.600sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1  ali follow..  13  2......................GGAVVDEGPTGVKAPDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTVITGLGLALNFQPSLIMLNRYFSKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGFLILGGLLLNCCVCAALMRPLVVTAQPGSGP-------------------------------------PRPSRRLLDLSVFRDRGFVLYAVAASVMVLGLFVPPVFVVSYAKD-LGVPDTKAAFLLTILGFIDIFARPAAGFVAGLGK-YSVYLFSFSMFFNGLADLAGSTAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTHKFSSAIGLVLLMEAVAVLVGPPSGGKLLDAVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPE 420
56 -31.300sp|Q8IWD5|MFS6L_HUMAN Major facilitator superfamily domain-containing protein 6-like OS=Homo sapiens GN=MFSD6L PE=2 SV=2  ali follow..  12  10..........................................SRALGVAKLFHLVCGVREACVTPFLTLYLRQLGLAAPWVGTLMGTKHLIAAFWAPVCAFLAKSYRRRALLIGSLLGSVGASLLMVLRRTFILSLGSVAFWELLTAPLQVADDSLYEFLDFVDATDRYRSLWVWRLLGMSAGVCGITALVGQLD-GVVHFYGYSVVSTLALLVSIAFPIPICQQWEPSYKRVKALS----------------------------------------IVGGDPHLILLASTTVLVGAIVSTVQNFLFWHMKD-HGSGELVMGFSVALSLLGEILLHPFKATLLRKLSRTG--LVGLGLSCLAGQLLYYSFLWSWWSVLPIQILSAISNRALWWAVGASVEDLATPRMERALSALFRGHYGSGCSLGSFVGGFVVMFSLAVLYQACCVALLLWLALLLSIQRRLPRERKIKYSK. 555
57 -31.300sp|O00624|NPT3_HUMAN Sodium-dependent phosphate transport protein 3 OS=Homo sapiens GN=SLC17A2 PE=2 SV=2  ali follow..  13  83........................................................................VYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGLLISSLLTLFTPLAAGVILVIMVRTVQGMAQGMATGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFIILCVGGLISQALSWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPC------------------------SVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIFLGFFSHFWLCTIILTYLPTYISTLLHVNIRDSGVLSSLPFIAAASCTILGGQLADFLLSRRKLFSSLGLLLPSICAVALPFVASSYVITIILLILIPGTSNLCDSGFIINTLDIAPRYASFLMGISRGFGLIAGIISSTATGFLIS....................................... 433
58 -31.100sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2  ali follow..  13  2.....QEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTSPVIPALERDLHLTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSAAGYALMAGAHGLWMLLLGRTLTGFAGGLTACIPVYVSEIAPPGVRGALGATPQLMAVFGSLSLYALGLLLP-----WRWLAVAGEAPVLIMILLLSFMPNSPRFLLSRGRDEEALRALAWLRGTDVDVHWEFEQIQDNVRRQSSRVSWA--------EARAPHVCRPITVALLMRLLQQLTGITPILVYLQSIFDSTAVLLPDDAAIVGAVRLLSVLIAALTMDLAG--RKVLLFVSAAIMFAANLTLGLYLTLVPLLATMLFIMGYAVGWGPITWLLMSEVLPLRARGVASGLCVLASWLTAVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTGCCVPETKGRSLEQIES. 496
59 -31.000sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1  ali   15  125.GLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW.......................................................................................................................................................................................................................................................................................................... 300
60 -31.000sp|Q9Y2C5|S17A4_HUMAN Putative small intestine sodium-dependent phosphate transport protein OS=Homo sapiens GN=SLC17A4 PE=2 SV=1  ali follow..  11  2........STGPDVKATVGDISSDGNLNVAQEECSRKGFCSVRHGLALILQLCNFSIYTQQMNLSIIPAMVNAYDWSPEIQGIILSSLNYGSFLAPIPSGYVAGIFGAKYVVGAGLFISSFLTLFIPLAAGVALLIVLRIVQGIAQVMVTGQYSIWVKWAPPLERSQLTTIAGSGSMLGSFIVLLAGGLLCQTIGWPYVFYIFGGIGCACCPLWFPLIYDDPVNHPF------------------------SAGEKRYIVCSLAQQDCSPGWSLPIRAMIKSLPLWAILVSYFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGLLADFLLSRRKLFTAIGVLFPSVILVSLPWVRSSHSMTMTFLVLSSAISSFCESGALVNFLDIAPRYTGFLKGLLQVFAHIAGAISPTAAGFFIS-GWRNVFLLSAAVNISGLVFYLIFGRADVQDWAKEQTFT 495
61 -30.900sp|Q9BYW1|GTR11_HUMAN(removed signalp:1-24) Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1  ali follow..  12  1....................................................TFQFGYNLSIITLHIQEFTNETHLVLLMWSLIVSLYPLGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSGSFEMIMLGRLLVGVNAGSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGRELLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLAGELEELEEERAACQGCRARRPWELFQHRAL--RRQVTSLVVLGSAMELCGNDSVYAYASSVFRKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVG--RRVLLIGGYSLMTCWGSIFTVA-AMACIFAFILSFGIGPA---GVTGILATELFDQMARPAACMVCGALMWIMLILVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPETKGKTFQEISK. 445
62 -30.800sp|P22732|GTR5_HUMAN(removed signalp:1-29) Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1  ali follow..  15  1.....................................................FQYGYNVAAVALLMQQFYNETYYLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSTSFELIIISRLLVGICAGSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGRNLLANVDGWPILLGLTGVPAALQLLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSL--RWQLLSIIVLMGGQQLSGVNAIYYYADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLG--RRLLLLLGFSICLIACCVLTAA-SIVCVISYVIGHALGPS---PIPALLITEIFLQSSRPSAFMVGGSVHWLSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQ. 444
63 -30.300sp|Q96SL1|DIRC2_HUMAN Disrupted in renal carcinoma protein 2 OS=Homo sapiens GN=DIRC2 PE=2 SV=1  ali follow..  13  1MGSRWSSEEERQPLLGPGLGPGLGASWRSREAAAAALPAAVPGPVLLLFSLLAFVQGLVWNTWGPIQNSARQAYGFSSWDIALLVLWGPIGFLPCFAF-MWLLDKRGLRITVLLTSFLMVLGTGLRCIPIKRRLIHGGQMLNGLAGPTVMNAAPFLSTTFSADERATATAIASMLSYLGGACAFLVGPLVVPAPNGTSPLLAAESSRAHIKDRIEAVLYAE-----------------FGVVCLIFSATLAYFPPRPPLPPSVAAASQRLSYRRSVCRLLSNFRFLMIALAYAIPLGVFAGWSGVLDLILTP-AHVSQVDAGWIGFWSIVGGCVVGIAMARFADFIRGMLKLILLLLFSGATLSSTWFTLPLTTVTLYASCILLGVFLNSSVPIFFELFVETVYPVPEGITCGVVTFLSNMFMGVLLFFLTFYHT-ELSWFNWCLPGSCLLSLLLILCFRESYDRLYLDVVVS. 477
64 -30.200sp|Q96JT2|S45A3_HUMAN(removed signalp:1-33) Solute carrier family 45 member 3 OS=Homo sapiens GN=SLC45A3 PE=2 SV=1  ali follow..  14  3...............................................................ITYVPPLLLEVGVEEKFMTMVLGIGPVLGLVCVPLLGSASDRYGRRPFIWALSLGILLSLFLIPRAGWLLLILGVGLLDFCGQVCFTPLEALLSDLFDPDHCRQAYSVYAFMISLGGCLGYLLPAI-PYLGTQEECLFGLLTLIFLTCVAATLLVAEEAALGPTEPA------------EGLSAPSLSPHCCPCRARLAFRNLGALLPRLHQLCCRM--RTLRRLFVAELCSWMALMTFTLFYTDFVRRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRF--GTRAVYLASVAAFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHRERGICLDLAILDSAFLLSQVAPSLFMGSIVQLSVTAYMVSAAGLGLVAIYFATQVVFDKSDLAK...... 517
65 -30.100sp|Q8WUG5|S22AH_HUMAN Solute carrier family 22 member 17 OS=Homo sapiens GN=SLC22A17 PE=2 SV=1  ali follow..  12  82.................................................................LTTNAIGQWDLLGWQVILEQILFILGFASGYLFLGYPADRFGRRGIVLLTLGLVGPCGVGGAAAGSSTGVMALRFLLGFLLAGVDLGVYLMRELCDPTQRLRVALAGELVGVGGHFLFLGLALVSKD---WRFLQRMITAPCILFLFYGWPGLFLESAR-VKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLNYRNIWKNLLILGFTNFIAHAIRHCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSMTLTGIASLVLLGLNPNRDLNEAAITTFSVLGLFSSQAAAILSTLLAAEVIPTTVRGRGLGLIMALGALGGLSGPAQR-LHMGHGAFLQHVVLAACALLCILSIMLLPETKRKLLPEVLRD. 507
66 -29.700sp|Q9NSA0|S22AB_HUMAN Solute carrier family 22 member 11 OS=Homo sapiens GN=SLC22A11 PE=1 SV=1  ali follow..  13  124.................................................................FTSTIVAKWDLSQGLKPLSQSIFMSGILVGSFIWGLLSYRFGRKPMLSWCCLQLAVAGTSTIFAPTFVIYCGLRFVAAFGAGIFLSSLTLMVEWTTTSRRAVTMTVVGCAFSAGQAALGGLAFALRD-----WRTLQLAASVPFFAISLISWWLPESARWLIIKGKPDQALQELRKVARINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAMLVVNFSLLISYYGLVFDLQS-LGRDIFLLQALFGAVDFLGRATTALL-----SFLGRRTIQAGSQAMAGLAILANMLVPQDLQTLRVVFAVLGGCFGISLTCLTIYKAELFPTPVRMTADGILHTVGRLGAMMGPLIL-MSRQALPLLPPLLYGVISIASSLVVLFFLPETQGLPLPDTIQD 526
67 -29.500sp|Q8N370|LAT4_HUMAN(removed signalp:1-32) Large neutral amino acids transporter small subunit 4 OS=Homo sapiens GN=SLC43A2 PE=1 SV=1  ali follow..  12  51...........................................................................AQDEMLNLAFTVGSFLLSAITLPLGIVMDKYGPRKLRLLGSACFAVSCLLIAYGALSVLIFIALALNGFGGMCMTFTSLTLPNMFG-DLRSTFIALMIGSYASSAVTFPGIKLIYDAGVSFIVVLVVWAGCSGLVFLNCFFNWPLKQFYKQVTTVGRRLSVGSSMRSAKEQVALQEGHKLCLSTVDLEVKCQPDAAVAPSFMHSVFSPILLLSLVTMCVTQLRLIFYMGAMNNILKFLVSGDQKTVGLYTSIFGVLCLLTAPVIGYIMDWRLKECEMRAFAFTNLLLVGFGVTCLIPNLPLQILSFILHTIVRGFIHSAVGGLYAAVYPSTQFGSLTGLQSLISALFALLQQPLFLAMMGPLQGDPLWVNVGLLLLSLLLYLICYRRQLERQLQQRQED 520
68 -29.300sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=2 SV=1  ali   14  68.PSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGRFQWILFFVLGLALMADGVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLSMSLAVNASFASLSSFVQGYGAFLFCRLISGIGGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYASAMAWSITNYHFHSWRVFVIVCALPCTVSMVALKFMPES............................................................................................................................................................................................................................................................ 300
69 -29.300sp|P11169|GTR3_HUMAN(removed signalp:1-21) Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1  ali follow..  11  1.....................................................FQFGYNTGVIEKIIKEFINKTVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKSVEMLILGRLVIGLFCGCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSY--RQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPI--YATIGAGVVNTIFTVVSLFLVERAG--RRTLHMIGLGGMAFCSTLMTVS-CIGAILVFVAFFEIGPG---PIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITR. 442
70 -29.200sp|O00400|ACATN_HUMAN Acetyl-coenzyme A transporter 1 OS=Homo sapiens GN=SLC33A1 PE=1 SV=1  ali follow..  13  30LPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELSSILLLLFLYVLQGIPLGLAG-SIPLILQSKNVSYTDQAFF--SFVFWPFSLKLLWAPLVDAVGRKSWLVPTQYILGLFMIYLSTTPDVIALTVAFFLFEFLAATQDIAVGWALTMLSRENVGYASTCNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFF--------------------WGTVFLITTTLVALLKKENEVSVVKEETQGITDTYKLLFAIIKMPAVLTFCLLILTAKIGFSAADAVTGLKLVE-EGVPKEHLALLAVPMVPLQIILPLIISKYTAGPQPLNTFYKAMPYRLLLGLEYALLVWYYYIVVLLSYALHQVTVYSMYVSIMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECVGASNQNCRTPDAV.................. 493
71 -29.100sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=2 SV=1  ali   2.....................................................................................MIVYLGMMAGAFILGGLADKLGRKRVLSMSLAVNASFASLSSFVQGYGAFLFCRLISGIGGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYASAMAWSIIPHYGWGWRVFVIVCALPCTVSMVALKFMPESPRRAKGTPEKVFTVSNIKTPKQMDEFIEIQSSTGTWYQRWLVRFKTIFKQVWDNALYCVMGPYRMNTLILAVVWFAMAFSYYGLTVWFPDMIRFQDEEYKSKMKVFFGEHVYGATINFTMENQIHQ.............................................................................................................................. 300
72 -29.100sp|Q9NRA2|S17A5_HUMAN Sialin OS=Homo sapiens GN=SLC17A5 PE=1 SV=2  ali follow..  11  2.....RSPVRDLARNDGEESTDRTPLLPGAPRAEAAPVCCSARYNLAILAFFGFFIVYALRVNLSVLVDMVDKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAAGVGPLIVLRALEGLGEGTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKR-------------------------SHYEKEYILSSLRNQLSSQKSVPWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMVGPVIAKSLTP-EWQTVFYIAAAINVFGAIFFTLFAKGEVQNWALNDHHG 492
73 -29.100sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1  ali follow..  13  2...................PSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANSYEMLILGRFLIGAYSGTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTH--RQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVGQPA--YATIGAGVVNTVFTLVSVLLVERAG--RRTLHLLGLAGMCGCAILMTVA-SIVAIFGFVAFFEIGPG---PIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQISA. 481
74 -28.900sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2  ali follow..  13  15............................................AVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKSFEMLILGRFIIGVYCGTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAY--RQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQPV--YATIGSGIVNTAFTVVSLFVVERAG--RRTLHLIGLAGMAGCAILMTIA-SIVAIFGFVAFFEVGPG---PIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIAS. 465
75 -28.800sp|Q9P2U7|VGLU1_HUMAN Vesicular glutamate transporter 1 OS=Homo sapiens GN=SLC17A7 PE=2 SV=1  ali follow..  10  21.RLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVIVSMVNQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAAHYGCVIFVRILQGLVEGTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPS-------------------ISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAP-RYASILMGISNGVGTLSGMVCPIIVGAMTK-EWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMS 504

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.