current user: public

If you have questions about the server, please let us know.

Query: sp|Q8TEV8|SMCR5_HUMAN Smith-Magenis syndrome chromosomal region candidate gene 5 protein OS=Homo sapiens GN=SMCR5 PE=2 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MRRCLRVKTRRGQLGLASSCFEQHSCFSPRVNRILSAVQNTLCTGPSSQAPPQPPQASPPAAADHSRTPSLLASSHSASGGESLFQLYIASLAWPQNCCVLESCRRIPLGGLSSMENRRPLLRKGRLLRGQIHHSQTNELLast
1 -114.000sp|Q8TEV8|SMCR5_HUMAN Smith-Magenis syndrome chromosomal region candidate gene 5 protein OS=Homo sapiens GN=SMCR5 PE=2 SV=1  ali  100  1MRRCLRVKTRRGQLGLASSCFEQHSCFSPRVNRILSAVQNTLCTGPSSQAPPQPPQASPPAAADHSRTPSLLASSHSASGGESLFQLYIASLAWPQNCCVLESCRRIPLGGLSSMENRRPLLRKGRLLRGQIHHSQTNEL 140
2 -7.370sp|Q6ZN28|MACC1_HUMAN Metastasis-associated in colon cancer protein 1 OS=Homo sapiens GN=MACC1 PE=1 SV=2  ali   18  10...CLHSLGKEGPFKVLSNCYAQAKALPSPAATIWDYIHKTTSIGIYGPKYIHPSFTVVLTVCGHNYMPGQLTISDIKKGGKNI----VVFQLWGKQSFLLDKPQDLSISIFSCDEGERKEIKQKQLEAGEVVH...... 167
3 -6.210sp|B0FP48|UPK3L_HUMAN(removed signalp:1-33) Uroplakin-3b-like protein OS=Homo sapiens GN=UPK3BL PE=2 SV=1  ali follow..  12  114......................................TKIGCNHPNDEGPVAETKWSSDTRLQQAQALRAVPGPQS---PGTVVIIAILSILLAVLLTVLLAVLIYTCFNSCRSTSLSGPEEAGSVRRYTTHL...... 220
4 -6.180sp|Q86YV5|SG223_HUMAN Tyrosine-protein kinase SgK223 OS=Homo sapiens GN=SGK223 PE=1 SV=2  ali   24  1MHQTLCLNPESLKM---SACFVEHNCFCLRSDHQLVAGPPQPRAGSLPPPPNSSPYSKPTIAVK----PTMMSSEASDVWTEA......................................................... 102
5 -5.950sp|Q9HAP2|MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens GN=MLXIP PE=1 SV=2  ali   16  28.....................EEARRLREEIEELNATIISCQQLLPATGVPVTRRQFDHMKDMFDEYVKTLFESFKGMVSTSSLEELHRTALSWLDQHCSLPILRPMVLSTLRQLSTSTSILTDPAQLPEQASKAVTRI. 162
6 -5.900sp|Q6V1P9|PCD23_HUMAN Protocadherin-23 OS=Homo sapiens GN=DCHS2 PE=2 SV=1  ali   18  156...................................SPIPYHLGSLPEGMTPNFSPSLSLLTMQPPALSPLLREGELLGT............................................................. 199
7 -5.790sp|Q9BRB3|PIGQ_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Homo sapiens GN=PIGQ PE=1 SV=3  ali   28  218...CTQVQRVRPPQQPQVEGWSPWGL--PSGSALAVGVE-----GPCQDEPPSP----------HPLAPS--AEQHPASGG------------------LKQSLTPVPSGPGPSLPEPHGV................... 299
8 -5.640sp|Q96MM7|H6ST2_HUMAN Heparan-sulfate 6-O-sulfotransferase 2 OS=Homo sapiens GN=HS6ST2 PE=2 SV=2  ali   30  6..........................................CAVREFEPPRQPERGAPVRTT-HSRVEAELAASRPGS--------------------VAASVRAGPPRGVSHGFHTRPLLDKPRKASSSLAGAACAPL 86
9 -5.630sp|O15467|CCL16_HUMAN(removed signalp:1-23) C-C motif chemokine 16 OS=Homo sapiens GN=CCL16 PE=1 SV=1  ali follow..  17  15...CLKYYEKVLPRRLVVGYRKALNCHLPAI--FVTKRNREVCTNPNDD........................................................................................... 59
10 -5.610sp|Q96PX1|RN157_HUMAN RING finger protein 157 OS=Homo sapiens GN=RNF157 PE=2 SV=3  ali   20  1.HSCSESETQLSQRPSVQHLGEECGVTPESENLTLSAIDQSSCTGT----PLSSTISSPEGPASSSLAQSVMSMASSQISTDTVSSMSGSYIA............................................... 91

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Godzik A. Surface map comparison: studying function diversity of homologous proteins. J Mol Biol. 2001 Jun 8;309(3):793-806.