current user: public

If you have questions about the server, please let us know.

Query: sp|Q8WWB3|DYDC1_HUMAN DPY30 domain-containing protein 1 OS=Homo sapiens GN=DYDC1 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDLLast
1 -64.900sp|Q8WWB3|DYDC1_HUMAN DPY30 domain-containing protein 1 OS=Homo sapiens GN=DYDC1 PE=1 SV=1  ali  100  1MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL 177
2 -48.600sp|Q96IM9|DYDC2_HUMAN DPY30 domain-containing protein 2 OS=Homo sapiens GN=DYDC2 PE=1 SV=1  ali follow..  26  1METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNP-LEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKS. 175
3 -30.500sp|Q9C005|DPY30_HUMAN Protein dpy-30 homolog OS=Homo sapiens GN=DPY30 PE=1 SV=1  ali follow..  37  55...AYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN................................................................................................................................. 99
4 -29.400sp|Q96M32|KAD7_HUMAN Putative adenylate kinase 7 OS=Homo sapiens GN=AK7 PE=2 SV=3  ali   35  232...NYLMTYVMPTLIQGLNECCNVRPEDPVDFLAEYLFKNNPEAQ.................................................................................................................................... 273
5 -23.800sp|A4FU69|EFCB5_HUMAN EF-hand calcium-binding domain-containing protein 5 OS=Homo sapiens GN=EFCAB5 PE=1 SV=2  ali   18  172...AYLLDKLLPTLVPGVENMLTQVEKDPINYLGEYLIRNNPNYIKDPGMSGYQRLMKEVTEDLKIY.............................................................................................................. 248
6 -19.500sp|Q6ZTW0|TPGS1_HUMAN Tubulin polyglutamylase complex subunit 1 OS=Homo sapiens GN=C19orf20 PE=2 SV=2  ali follow..  18  35.EEDFLRQVVTEMLRAALLKVLEARPEEPIAFLAHYFENMGLRSPVNGGAGEPPGQLLLQQQRLGRA.............................................................................................................. 101
7 -18.900sp|A4FU69|EFCB5_HUMAN EF-hand calcium-binding domain-containing protein 5 OS=Homo sapiens GN=EFCAB5 PE=1 SV=2  ali   16  22...AYLLDKLLPTLVPGVENMLTQSKFDPINYLGEYLIRNNPNYIKDPGMSGYQRLMKEVTEDLKIYVPDTICNRVSKMKENVKQNRKQRESIDK.................................................................................. 126
8 -16.600sp|A6NFE3|EFC10_HUMAN EF-hand calcium-binding domain-containing protein 10 OS=Homo sapiens GN=EFCAB10 PE=2 SV=2  ali follow..  30  1METEYLEKHIKEVVSYLTSALLFFRPEKPKEYLISLLER.......................................................................................................................................... 48
9 -16.300sp|Q8N0W5|IQCK_HUMAN IQ domain-containing protein K OS=Homo sapiens GN=IQCK PE=2 SV=1  ali follow..  11  129..KEYLETFIFPVLLPGMASLLHQAKKIACDFLTEWLYNQNPKRAGEPFTEPLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQEQKVKCKMEDDAVPAAKMKI................................................. 284
10 -16.000sp|Q49A92|CH034_HUMAN Uncharacterized protein C8orf34 OS=Homo sapiens GN=C8orf34 PE=1 SV=2  ali follow..  24  1MASAYLEKNIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRG.................................................................................................................................... 53
11 -12.200sp|A6NNX1|CA230_HUMAN RIIa domain-containing protein C1orf230 OS=Homo sapiens GN=C1orf230 PE=4 SV=1  ali follow..  16  35.NEKYLRTHVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIHMQLIKDKKA......................................................................................................................... 91
12 -11.400sp|Q7Z7H3|CB062_HUMAN Uncharacterized protein C2orf62 OS=Homo sapiens GN=C2orf62 PE=2 SV=1  ali follow..  14  314.HASYLRQHAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHR.......................................................................................................................... 369
13 -11.200sp|Q99417|MYCBP_HUMAN C-Myc-binding protein OS=Homo sapiens GN=MYCBP PE=1 SV=3  ali follow..  23  16...RYLEKSVLDTLTKVLVALYEEKPNSALDFLKHHL............................................................................................................................................ 52
14 -11.100sp|Q9H6J7|CK049_HUMAN UPF0705 protein C11orf49 OS=Homo sapiens GN=C11orf49 PE=2 SV=2  ali follow..  11.DYEYLAQRVLTYMEDAVCQLLENREDGIARFFTEYF............................................................................................................................................ 51
15 -11.100sp|A6NNW6|ENO4_HUMAN Enolase-like protein ENO4 OS=Homo sapiens GN=ENO4 PE=2 SV=2  ali   16  25...EYYRENVPRRLEELLNSTFYLQPADVYGHLKANCFS.......................................................................................................................................... 61
16 -10.800sp|Q15506|SP17_HUMAN Sperm surface protein Sp17 OS=Homo sapiens GN=SPA17 PE=1 SV=1  ali follow..  24  1MSIPFSNTHY-GNLLEGLTEILREQPDNIPAFAAAYF............................................................................................................................................ 43
17 -9.990sp|Q9H7S9|ZN703_HUMAN Zinc finger protein 703 OS=Homo sapiens GN=ZNF703 PE=1 SV=1  ali follow..  64LHPEYLQ----PLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAANGLGAEKDPGRSAPGAASAAAALKQLGDSPAEDKSSFKPYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSSSPGGSRGGSPHHSDCKNGG. 235
18 -9.510sp|Q96C74|ROP1L_HUMAN Ropporin-1-like protein OS=Homo sapiens GN=ROPN1L PE=1 SV=2  ali follow..  4PDTMFCAQQI-PDILKQFTAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVELTDLEQK...................................................................................... 100
19 -9.460sp|Q9HAT0|ROP1A_HUMAN Ropporin-1A OS=Homo sapiens GN=ROPN1 PE=1 SV=2  ali follow..  19  10.....IPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRA.................................................................................................................... 65
20 -9.350sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1  ali   10  1MEEGFRDRA---AFIRGAKDIAKE------------VKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPAPSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRE.... 158

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.