current user: public

If you have questions about the server, please let us know.

Query: sp|Q8WXG1|RSAD2_HUMAN(removed signalp:1-15) Radical S-adenosyl methionine domain-containing protein 2 OS=Homo sapiens GN=RSAD2 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# Score Template Links and tools%idFirst VFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDWLast
1 -103.000sp|Q8WXG1|RSAD2_HUMAN(removed signalp:1-15) Radical S-adenosyl methionine domain-containing protein 2 OS=Homo sapiens GN=RSAD2 PE=1 SV=1  ali  100  1VFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW 346
2 -48.700sp|Q9NZB8|MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens GN=MOCS1 PE=1 SV=3  ali   16  40...........................SEEVSRRRQFLREHAAPFSAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGKANLLTTEEILTLARLFVKEGIDKIRLTGGEPLIRPDVVDIVAQLQRLE---GLRTIGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELGYN---PVKVNCVVMRGLNEDELLDFAALTEGLP---LDVRFIEYMPFDGNK---NFKKMVSYKEMLDTVRQQWPELEKVPEEESSTAKAFKIPGFQGQ.................................................... 300
3 -36.100sp|Q6NUM6|TYW1B_HUMAN tRNA wybutosine-synthesizing protein 1 homolog B OS=Homo sapiens GN=TYW1B PE=2 SV=2  ali   15  39......................................................ESHRCMETTPSLACANKCVFCWWHHGTEWLWKMDQPEMILKEAIEMTVKHCALSLGEPIMYPEINRFLKLLHQCKI-----SSFLVTNAQFPAEI---RNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQQFLDSLKALAVKQQRTVYRLMLVKAWNVDEAYAQLVSLGNPDFIEVKGVTYCRESSASSLTMAHVPWHEEVVQFVRELVDLIPEYEIACEHEHSNC................................................................ 288
4 -32.500sp|Q9NV66|TYW1_HUMAN tRNA wybutosine-synthesizing protein 1 homolog OS=Homo sapiens GN=TYW1 PE=1 SV=2  ali   13  103......................................................ESHRCMETTPSLACANKCVFCWRENHQNMIKQFKGVPGVKAEREGMTVKHCALSLGEPIMYPEINRFLKLLHQCKI-----SSFLVTNAQFPAEI---RNLEPVTQLYVSVDASTKDSLKKIDR-PLFKDFWQRFLDSLKALAVKQQRTVYRLTLVKAWNVDELQAYAQLVS........................................................................................................................ 293
5 -29.500sp|Q9NZB8|MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens GN=MOCS1 PE=1 SV=3  ali   14  1........................................................................................................................................IGVTTNGINLARLLPQLQKAGLSAINISLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELGYN---PVKVNCVVMRGLNEDELLDFAALTEGLP---LDVRFIEYMPFDGNKWNFKK--MVSYKEMLDTVRQQWPELEKVPEEESSTAKAFKIPGFQGQFITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLR. 203
6 -23.700sp|Q9NV66|TYW1_HUMAN tRNA wybutosine-synthesizing protein 1 homolog OS=Homo sapiens GN=TYW1 PE=1 SV=2  ali   13  1.............................................................................ENHQNMIKQFKGVPGVKAEREGMTVKHCALSLGEPIMYPEINRFLKLLHQCKI-----SSFLVTNAQFPAEI---RNLEPVTQLYVSVDASTKDSLKKIDR-PLFKDFWQRFLDSLKALAVKQQRTVYLTLVKAWNVDEAYAQLVSLGNPDFIEVKGVTYCGESSASSLTMAHVPWHEEVVQFVHELVDLIPEYE.......................................................................... 192
7 -20.100sp|Q6NUM6|TYW1B_HUMAN tRNA wybutosine-synthesizing protein 1 homolog B OS=Homo sapiens GN=TYW1B PE=2 SV=2  ali   21  189......................................................ESHRCMETTPSLACANKCVFCWWHHGTEWLWKMDQPEMILKEAIEMTVKHCALSLGEPIMYPEINRFLKLLHQCKI-----SSFLVTNA........................................................................................................................................................................................................... 300
8 -16.900sp|Q9HA92|RSAD1_HUMAN Radical S-adenosyl methionine domain-containing protein 1, mitochondrial OS=Homo sapiens GN=RSAD1 PE=2 SV=2  ali follow..  16  21......................................RRRVENAGGSPSPEPAGRRAALYVHWP--CEKRCSYCNFNKYIPRRLEEAEAQTLLRLSGVQRVESVFFGGGTPSL-HTVAAVLEAVAQAAHLPADLEVTLEANTSAPGSRLAEFGAAGVNRLSIGLQSLDDTELRLLGRTHSACDALRTLAEARRLFPG-RVSVDLMLGLPAQQVGPGQLQELLHHCDDHLSLYQLSLERGTA----------------------LFAQVQRGALPAPDPELAAEMYQR-----------------GRAVLREAGFHQYEVSNFARNGALSTHNWTYWQCGQYL... 297
9 -16.100sp|O43766|LIAS_HUMAN Lipoyl synthase, mitochondrial OS=Homo sapiens GN=LIAS PE=2 SV=3  ali follow..  14  134................................................................GDTCTRGCRFCSVKTARNPPLDASEPYNTAKAIAEWGLDYVVLTDRDDMPDGGAEHIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVLSGLDVYAHNVETV-PELQSKVRDPRANFDQSLRVLKHAK-KVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLKVEE----YITPEKFKYWEKVGNELGFHYTASGPLVRSSY............................................................ 353
10 -14.300sp|Q9H9T3|ELP3_HUMAN Elongator complex protein 3 OS=Homo sapiens GN=ELP3 PE=1 SV=2  ali follow..  13  26LIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVD--IIAAVPPQYRKVLMPKLKAKPIRTASGIASFTGNICVYCIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTGCTRLEIGVQSVYEDVARDTNRG----HTVKAVCESFHLAKDSGFKVVAHMMPGLERDIEQFTEFFEAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVAR................................................................................ 351
11 -12.100sp|Q5VV42|CDKAL_HUMAN CDK5 regulatory subunit-associated protein 1-like 1 OS=Homo sapiens GN=CDKAL1 PE=1 SV=1  ali follow..  13  197..................................................PKIRKNPLIEIISINTGCLNACTYCKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSGRD-IGTNLPTLLWKL--VEVIPEGAMLRLMTNPPYILEHLEEMAKRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGITIATDI-ICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPGTPAAKMEQVPAQVKKQRTKDLSRVFHSYS.......................................................................... 428
12 -11.900sp|Q96SZ6|CK5P1_HUMAN CDK5 regulatory subunit-associated protein 1 OS=Homo sapiens GN=CDK5RAP1 PE=1 SV=2  ali   16  63......................RLLAVAESGQQAANVLLSLDETYADVMPVQTSASATSAFVSIMRGCDNMCSYCIVPFTRGRERSLEEVKKLSEQLGLQGLKEVTLLGRDNS-KQGGLRFAHLLDQVSRVDPEMRIRFTSP---FPDEVLQLIHERCKQIHLPAQSGSSRVLEAMRRGYSREAYVELVHHIRESIPGVSLSSDF............................................................................................................................................. 292
13 -9.120sp|Q9UND3|NPIP_HUMAN Nuclear pore complex-interacting protein OS=Homo sapiens GN=NPIP PE=2 SV=3  ali follow..  16  1.....................................................................MFC--CLGYEWLSGGCKTWHSAWVINTLADHRHRGTDF-GGSPWLL-----ITVFLRSYKF-----AISLCTSYLCVS--FLKTIFPSQNGHDGSTDVQQRARRSNRRRQEGIKIVLEDIFTLWRQVEKVRAKIRKMKVTTKVNRHDKINGKRKTAKE....................................................................................................................... 145

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.