current user: public

If you have questions about the server, please let us know.

Query: sp|Q96BF3|TMIG2_HUMAN(removed signalp:1-22) Transmembrane and immunoglobulin domain-containing protein 2 OS=Homo sapiens GN=TMIGD2 PE=1 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
3 -47.600sp|Q9H106|SIRPD_HUMAN(removed signalp:1-29) Signal-regulatory protein delta OS=Homo sapiens GN=SIRPD PE=2 SV=2  ali follow..  17  1FHVQQTEMSQTVSTGESIILSCSVPNTLPNG--PVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIK-AIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSR-----AHHDAHTCLS--ALPERNSTNYFVQPCCCLRLLGLTGLLSK.................................................................................... 168
5 -47.300sp|O14931|NCTR3_HUMAN(removed signalp:1-18) Natural cytotoxicity triggering receptor 3 OS=Homo sapiens GN=NCR3 PE=1 SV=1  ali follow..  23  1LWVSQ-PPEIRTLEGSSAFLPCSFNASQGRLAISVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRV--EVLGLGVGTGNGTRLVVEKEHPQLGAGTV......................................................................................................................................... 121
7 -42.900sp|P40259|CD79B_HUMAN(removed signalp:1-28) B-cell antigen receptor complex-associated protein beta chain OS=Homo sapiens GN=CD79B PE=1 SV=1  ali follow..  11  16SRIWQSPRFIARKRGFTVKMHCYMNSASG----NVSWLWKQEMDENPQQLKLE-------KGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTS-EVYQGCGTELRVMGFSTLA---QLKQRNTLKDGIIMIQTLLIILFIIV--PIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGE.............................................................. 196
9 -40.800sp|P10747|CD28_HUMAN(removed signalp:1-18) T-cell-specific surface glycoprotein CD28 OS=Homo sapiens GN=CD28 PE=1 SV=1  ali follow..  15  3ILVKQSP--MLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVA---FIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQ.......................................................................... 189
10 -40.600sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  16  2VVMTQSPLSLPVTLGQPASISCRSSQSYSDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGT---HWSWTFGQGTKVEIKR................................................................................................................................................... 113
11 -40.600sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  19  2VVMTQSPLFLPVTLGEPASIQCRSSQSYRXGXTYLXWYLQKPGQSPELLIYLSSYRDSGVPDRFSDSGSGTDFTLKITRVQAEDVGVYYCMQATX---SPYTFGQGTKLXIKR................................................................................................................................................... 113
12 -40.500sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  19  2IVMTQSPLSLPVTPGEPASISCRSSQSHSDGFDYLNWYLQKPGQSPXLLIYALSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXAL---QAPITFGQGTRLEIKR................................................................................................................................................... 113
14 -40.200sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  15  2IQMTQSPSSVSASVGDRVTITCRASQDISH---WLAWYQQKSGKAPKLLIYSASSLENGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQAH---SVPLTFGGGTTVDIKR................................................................................................................................................... 108
15 -40.100sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  18  3IVMTQTPLSLPVTPGEPASISCRSSQSSGDGNTYLNWYLQKAGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLE---IPYTFGQGTKLEIRR................................................................................................................................................... 115
16 -40.100sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  18  2IVLTQSPGTLSLSPGERATLSCRASQS--VSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSSP---WTFGQGTKVEIKR................................................................................................................................................... 109
17 -40.100sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  18  2IVLTQSPLSLPVTPGEPASISCRSSQNLXSXGXYLDWYLXKPGXSPXLLIYLGSNRASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQ---TPLTFGGGTNVEIKR................................................................................................................................................... 112
18 -40.000sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  16  2IVMTQSPDSLAVSLGERATINCKSSQSSSNSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTP---YSFGQGTKLEIKR................................................................................................................................................... 114
19 -40.000sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IVLTQSPGTLSLSPGERATLSCRAALLSSRG--YLAWYQQKPGQAPRLLMYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP---RSFGQGTKVEIKR................................................................................................................................................... 109
20 -39.900sp|P10966|CD8B_HUMAN(removed signalp:1-18) T-cell surface glycoprotein CD8 beta chain OS=Homo sapiens GN=CD8B PE=1 SV=1  ali follow..  18  3.VLQQTPAYIKVQTNKMVMLSCEAKIS--LSNMRIYWLRQRQAPSSDSHAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVG---SPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPETQKGPLCSP................................................................................................................... 152
21 -39.800sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  18  2IQMTQSPSSLSASVGDRVTITCQASQDIRK---HLNWYDQKPGKAPRLLIYGASTLETGVPSRFSGSGSGTDFTLTISTLQPEDIGNYYCQQYD---NVPITFGQGTRVENKG................................................................................................................................................... 108
22 -39.800sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IVLTQSPGTLSLSPGERATLSCRASQSVSSG--YLGWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSLG---RTFGQGTKVEIKR................................................................................................................................................... 109
23 -39.800sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  16  2IQMTQSPSTLSASVGDRVTITCRASQSINT---WLAWYQQKPGKAPKLLMYKASSLESGVPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYN---SDSKMFGQGTKVEVKG................................................................................................................................................... 108
24 -39.700sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  16  6IVMTQSPLSLPVTPGEPASISCRSSQSHSNGYNYLDWYLQKPQQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQTP---QTFGQGTKVEIKR................................................................................................................................................... 117
25 -39.700sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  16  2IQMTQSPSPLSASVGDSVTITCQASQDIRN---SLIWYQQKPGKAPKFLIYDAENLEIGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYY---NLPYTFGQGTKLEIKR................................................................................................................................................... 108
26 -39.700sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  14  2IQMTQSPSTQPASVGDRVTITCRASQSINI---WLAWYQQKPEKAPKLLIYKASTLETGVPSRFSGSGSGTEFTLTINSLQPDDFATYYCQQYS---RYPYTFGQGTKLDIKR................................................................................................................................................... 108
27 -39.600sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  16  2IQMTQSPSSLSASVGDRVTITCRASQDITN---YVNWFQQRPGQAPKVLIYGASILETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYD---TLPLTFGGGTKVDIKR................................................................................................................................................... 108
28 -39.600sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  15  2IQMTQSPSSLSASVGDRVTIICRASQGIRN---DLTWYQQKPGKAPKELIYAASNLQSGVPSRFSGSGAGTEFTLTISSLQPEDFATYYCLQQN---SYPRSFGQGTKVEIKR................................................................................................................................................... 108
29 -39.600sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  16  2IQMTQSPSSLSASVGDRVTITCRASQSISS---YLSWYQQKPGKAPQVLIYAASSLPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNY---ITPTSFGQGTRVEIKR................................................................................................................................................... 108
30 -39.600sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTQSPSSLSVSVGDRVTITCQASQNVNA---YLNWYQQKPGLAPKLLIYGASTREAGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYN---NWPPTFGQGTKVEVKR................................................................................................................................................... 108
31 -39.600sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  15  2IVMTQSPDSLAVSLGERATINCKSSQSSSDNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNLP---WTFGQGTKVEIKR................................................................................................................................................... 114
32 -39.500sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  17  2IQMTQSPSSLSASVGDRVTITCRASQSISN---YLNWYQQKPGKAPKLLIYAASSLQSGVTSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSY---STLITFGQGTRLEIK.................................................................................................................................................... 107
33 -39.500sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IVLTQSPGTLSLSPGESATLSCRASQSVSS---NLAWYQQKRGQSPRLLIRDASSRANGIPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYS---TSPYTFGQGTKLEIKR................................................................................................................................................... 108
34 -39.500sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  16  2IQMTQSPSSLSASVGDRVTITCQASQDIIK---YLNWYQQTPGKAPKLLIYEASNLQAGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQ---SLPYTFGQGTKLQITR................................................................................................................................................... 108
36 -39.400sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  16  2IXMTQSPSSLSASVGDRVTITCRAGQSVNK---YLNWYQQKPGKAPKVLIFAASSLKSGVPSRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTTP---YTFGPGTKVEMTR................................................................................................................................................... 108
37 -39.300sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTQSPSSLSASVGDRVTITCRASQGIRN---DLTWYQQKPGTAPKRLIYGATSLQSGVPSRFSGSGSGTEFTLTINSLQPEDFATYYCLQYS---SFPWTFGQGTKVEVKR................................................................................................................................................... 108
38 -39.200sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTQSPSSLSASVGDRVTITCQASQDINH---YLNWYQQGPKKAPKILIYDASNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYD---TLPRTFGQGTKLEIKR................................................................................................................................................... 108
39 -39.200sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  18  2IQMTQSPSTLSVSVGDRVTITCEASQTVLS---YLNWYQQKPGKAPKLLIYAASSLETGVPSRFSGQGSGTXFTFTISSVXPXXFATYYCQXYLDLP---RTFGQGTKVDLKR................................................................................................................................................... 108
40 -39.200sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  15  2IQMTQSPSSLSASVGDRVTITCRAGHNITN---FLSWYQQKPGKAPTLLIYAVSNLQVGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNY---NFSFTFGGGTKVDNK.................................................................................................................................................... 107
41 -39.200sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  15  2IQMTQSPSSLSASVGDRVTITCQASQDISI---FLNWYQQKPGKAPKLLIYDASKLEAGVPSRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNLP---LTFGGGTKVDFKR................................................................................................................................................... 108
42 -39.200sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  15  2VQMTQSPSSLSASVGDRVIITCRASQSSVD---YLNWYQQKPGKAPKLLIFDTSNLQSGVPSRFSGGRSGTDFTLTISSLQPDDFATYYCQQSYTNP--EVTFGGGTTVDIKR................................................................................................................................................... 109
43 -39.200sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  15  2.SVLTQPPSVSGTPGQRVTISCSGGSSNGTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAW-DYRLSAVVFGGGTQLTVLR................................................................................................................................................... 112
44 -39.200sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IVLTQSPGTLSLSPGERATLSCRASQS--VSNSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSSP---QTFGQGSKVEIKR................................................................................................................................................... 109
45 -39.100sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  15  2.SALTQPRSVSGSPGQSLTISCSGAPCDVDGCESVSWYQQHPGKAPKLIIYGFSNRPSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYA---DSSVIFGAGTKLTVLR................................................................................................................................................... 110
46 -39.100sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  16  2IQMTQSPSSLSASVGDRVTITCQASQDISD---YLNWYQQKPGKAPKLLIYDASNLESGVPSRFSGGGSGAHFTFTISSLQPEDIATYYCQQYD---YLPWTFGQGTKVEIKR................................................................................................................................................... 108
47 -39.000sp|A6NJW9|CD8BL_HUMAN(removed signalp:1-18) Putative T-cell surface glycoprotein CD8 beta-2 chain OS=Homo sapiens GN=CD8BP PE=5 SV=2  ali follow..  16  3.VLQQTPAYIKVQTNKMVMLSCEAKIS--LSNMCIYWLRQRQAPSSDSHHEGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVG---SPELTFGKGTQLSVVVDFLPTTAQPTKKSTLKKRVCRLETQKGPLCS.................................................................................................................... 152
48 -39.000sp|P01732|CD8A_HUMAN(removed signalp:1-21) T-cell surface glycoprotein CD8 alpha chain OS=Homo sapiens GN=CD8A PE=1 SV=1  ali follow..  12  2.QFRVSPLDRTWNLGETVELKCQVLLSN--PTSGCSWLFQPRGAAASPTQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALS---NSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEAC...................................................................................................................... 143
49 -38.800sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  15  2IQLTQSPSSLSASVGDRVTITCRASQSVYN---YVAWFQQKPGKAPKSLIYDASTLQSGVPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSYP---YTFGQGTKVQIKR................................................................................................................................................... 108
50 -38.800sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  16  2IQMTQSPSTLSASVGDRVAITCRASQNISS---WLAWYQQKPGKAPKVLIYKSSSLESGVPSRFSGSGSGTDFTLTISSLXPXXFATYYCQQYNT----FFTFGPGTKVDIKR................................................................................................................................................... 107
52 -38.600sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  15  2.SALTQPRSLSGSPGQAVTISCTGLPSVVDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVG--NYIFVFGQGTDLTVLG................................................................................................................................................... 111
53 -38.600sp|P04435|TVB2_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region CTL-L17 OS=Homo sapiens GN=TCRB PE=2 SV=1  ali follow..  16  2..VSQNPRHNITKRGQNVTFRCDPISEHN----RLYWYRQTLGQGPEFLEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLAGLNQPQHFGDGTRLSI..................................................................................................................................................... 111
54 -38.600sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  13  2.SVLTQPPSASGTPGGRVTISCSGSSSNVGSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAW-DDSLDGYVFGTGTKVTVLR................................................................................................................................................... 112
55 -38.300sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTXSPSSLSASVGXRVTITCRASXTISS---YLXWYXXKPGKAPXLLIYAASXLHSGVPSRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSSP---TTFGXGTRLXIKR................................................................................................................................................... 108
56 -38.300sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  17  2..VLTQPPSVSVAPGETARLTCGGNDI---GSESVHWYQQKPGQAPVLVIYFDRDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQLW-DSSSEHVVFGGGTKLTVLSQP................................................................................................................................................. 110
57 -38.200sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  13  2.SALTQPASVSGSLGQSITISCTGTSSDVGGYNYVSWFQQHPGTAPKLIISEVRNRPSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYTSSN--SVVFGGGTKLTVLG................................................................................................................................................... 111
58 -38.100sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  13  2.SALTQPASVSGSPGQSITISCTGTTSDVGGYDFVSWYQQHPGKAPKLLIYDVNSRPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTT-TNSRAVFGGGTKLSVLG................................................................................................................................................... 112
59 -38.000sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  16  2IVMTQSPDSLAVSLGERATINCKSSQSSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP----TFGGGTKVEIKR................................................................................................................................................... 113
60 -37.900sp|P01737|TVA3_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region PY14 OS=Homo sapiens PE=1 SV=1  ali follow..  14  2.SVTQLGSHVSVSEGALVLLRCNYSSSVPP---YLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEKKSETSFHLTKPSAHMSDAAEYFCAVSDLEPNSKIIFGSGTRLSIR.................................................................................................................................................... 115
61 -37.900sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  18  1YDLTQPP-SVSVSPGQTASITCSGDKL---GDKDVCWYQQRPGQSPVLVIYQDNQRSSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWD---SMSVVFGGGTRLTVLS................................................................................................................................................... 106
62 -37.800sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  18  2IVLTQSPGTLSLSPGERATLSCRASQS--VSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTSP---RTFGQGTKVEIKR................................................................................................................................................... 109
63 -37.700sp|P01712|LV209_HUMAN Ig lambda chain V-II region WIN OS=Homo sapiens PE=1 SV=1  ali follow..  14  2SALTQPP-RVSGSPGQSVTISCTGSYSNVTGYNHVSWYQQDPGKVPKLMIYDVDKRPSGVPDRFSGSKSANTASLTISGLQANNEADYYCSSYGG--TYSLIFGGGTKLTVLG................................................................................................................................................... 111
64 -37.700sp|P01709|LV206_HUMAN Ig lambda chain V-II region MGC OS=Homo sapiens PE=1 SV=1  ali follow..  14  2SALTQPP-SASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEG--SDNFVFGTGTKVTVLG................................................................................................................................................... 111
65 -37.700sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  19  2IVMTQSPATLSVSPGERATLSCRASQSVSN---NLAWYQQKPGQPPRLLIYGASTRATGIPARFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNWP--PWTFGQGTRVEIKR................................................................................................................................................... 109
66 -37.700sp|P01707|LV204_HUMAN Ig lambda chain V-II region TRO OS=Homo sapiens PE=1 SV=1  ali follow..  13  2SALTQ-PRSVSGSPGQSVTISCTGTSSDVGAYNSVSWYQQHPGKAPKLMIFDVTKRPSGVPDRLSGSKSGDTASLTISGLRADDEADYYCCSYAG--RYSVIFGGGTKLTVLG................................................................................................................................................... 111
67 -37.600sp|P06889|LV405_HUMAN Ig lambda chain V-IV region MOL OS=Homo sapiens PE=1 SV=1  ali follow..  18  1YELTQPP-SVSVSPGQTATISCSGDKL---GESYYDWYQQSPGQSPLLVIYEGDKRPSGIPXRFSGSNSGNTATLTISGTESMDEADYYCQAWN---SSSVLFGGGTKLTVLG................................................................................................................................................... 106
68 -37.500sp|P01706|LV203_HUMAN Ig lambda chain V-II region BOH OS=Homo sapiens PE=1 SV=1  ali follow..  14  3..ALTQPRSVSGSPGQSVTISCAGTSSDVGGNHFVSWYQQHPGKAPKLIIYGVNKRPSGVPYRFSGSKSGNTASLTISGLQAEDEAHYYCCSYAG--RFTWVFGGGTNLTVLG................................................................................................................................................... 111
69 -37.500sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  16  2..VLSQPPSVSVAPGQTARITCGGDGI---GGKSVHWYQQKPGQAPVLVVHEDNDRPAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVW-DDRTAHVVFGGGTKLTVLG................................................................................................................................................... 108
70 -37.500sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  18  2YELTQPP-SVSVSPGQTARITCSANALPNQ---YAYWYQQKPGRAPVMVIYKDTQRPSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDN---SASIFGGGTKLTVLG................................................................................................................................................... 107
71 -37.500sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  19  2IVMTQSPVTLSVSPGERATLSCRASQS--ISNSYLAWYQQKPSGSPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWP---PTFGQGTRVEIKR................................................................................................................................................... 109
72 -37.400sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IVLTQSPGTLSLSPGERATLSCRASQS--VSNSFLAWYQQKPGQAPRLLIYVASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP---STFGQGTKVELKR................................................................................................................................................... 109
73 -37.400sp|P04437|TVA2_HUMAN(removed signalp:1-21) T-cell receptor alpha chain V region CTL-L17 OS=Homo sapiens GN=TCRA PE=2 SV=1  ali follow..  20  8.QVKQNSPSLSVQEGRISILNCDYTNSMFD---YFLWYKKYPAEGPTFLISISSIKDKNEDGRFTVFKSAKHLSLHIVPSQPGDSAVYFCAAKGAGTASKLTFGTGTRLQVT.................................................................................................................................................... 117
74 -37.300sp|P01705|LV202_HUMAN Ig lambda chain V-II region NEI OS=Homo sapiens PE=1 SV=1  ali follow..  11  3..ALTQPASVSGSPGQSITISCTGTTSDVGSYNFVSWYQQNPGKAPKLMIYEGNKRPSGVSNRFSGSKSGKTASLTISGLQVEDEADYYCCSYAGNS--TRVFGGGTRVTVLS................................................................................................................................................... 111
75 -37.300sp|P01704|LV201_HUMAN Ig lambda chain V-II region TOG OS=Homo sapiens PE=1 SV=1  ali follow..  12  2SALTQ-PASVSASPGQSITISCTGTTNDIGSYSYVSWYQQYPGKAPKVLIFDVNSRPSGVSHRFSGSKSGNTASLTISGLQAEDEAHYFCSSYRT--SGTIIFGGGTYVTVLR................................................................................................................................................... 111

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.