current user: public

If you have questions about the server, please let us know.

Query: sp|Q9BSE5|SPEB_HUMAN Agmatinase, mitochondrial OS=Homo sapiens GN=AGMAT PE=1 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350
# Score Template Links and tools%idFirst MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTVLast
1 -109.000sp|Q9BSE5|SPEB_HUMAN Agmatinase, mitochondrial OS=Homo sapiens GN=AGMAT PE=1 SV=2  ali  100  1MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV 352
2 -70.400sp|P05089|ARGI1_HUMAN Arginase-1 OS=Homo sapiens GN=ARG1 PE=1 SV=2  ali follow..  24  2..................................................................SAKSRTIGIIGAPFSKG-QPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTSGNLHGQPVSFLLKELCISAKDIVYIGLRDV--DPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAR. 308
3 -69.200sp|P78540|ARGI2_HUMAN Arginase-2, mitochondrial OS=Homo sapiens GN=ARG2 PE=1 SV=1  ali follow..  24  2..................................................SLRGSLSRLLQTRVHSKKSVHSVAVIGAPFSQG-QKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSGNLHGQPVSFLLRELCISSASIVYIGLRDV--DPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTR. 327
4 -6.630sp|Q9UQQ1|NALDL_HUMAN(removed signalp:1-34) N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Homo sapiens GN=NAALADL1 PE=2 SV=2  ali   12  2.............................................GTIALTRYGGVGRGAKAVNAAKHGVAGVLVYTDPADINDGLSSPDETFPNGVERGSYYEYFGDPLTRVDLANVSGFPPIPTQPIGFQDARDLLCNLNGTLAPATWQGALGCH-PADSQVNVNVLGIIRGAVEPDRYVLYGNHRDSWVHGAVDPSSGTAVLLELSRV--------------GTLLKKGTWRPRRSIVFASWGAEEFGLIGSTEFTEEFFNKLQERTVYINVDISVFANATLRVQGTPPVQSV----VFSATKEIRSPGPGDLSI.................................. 299
5 -5.970sp|Q8NAC3|I17RC_HUMAN(removed signalp:1-20) Interleukin-17 receptor C OS=Homo sapiens GN=IL17RC PE=1 SV=2  ali   13  104.............................................................................................................................................DVRSGAAARGRAALLLYSADDSGFERLVGALASA---LCQLPLRVAVDLWSRRELSAQGPVAWFHAQRRQTLQEGGVVVLLFSPGAVALCSEWLQDGVSGPGAHGPHDAFRASLSCVLPDFLQGRAPGSYVGACFDRLLHPDAVPALFRTVPVFTLPSQLPDFLGALQQPRAPRSGRLQERAEQVSRALQPALDS................ 295
6 -5.880sp|Q5TBK1|N42L1_HUMAN NEDD4-binding protein 2-like 1 OS=Homo sapiens GN=N4BP2L1 PE=2 SV=1  ali follow..  14  45........................................................................YLLRGLP---------GS--GKTTL---ARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNL---PYAVMALENNYEVIFREPDTRWKFNVQELARRNIHGVSREKIHRM............................................................................................................................................. 172
7 -5.590sp|Q9UHW5|GPN3_HUMAN GPN-loop GTPase 3 OS=Homo sapiens GN=GPN3 PE=1 SV=2  ali follow..  16  7...........................................................................................................................................................LVMGGKSTYCATMVQHCEALNRSVQVVNLDPAAEH-------NYSVMADIRELIEVDDVMEDDSLRFGPNG----------------GLVFCMEYFANNFDWLENCLGHVEDD---YILFD--------CPGQIELYTHLPVMKQLVQQLEQ-WEFRVCGVFLVDSQFMVESFKFISLAALSAMISL.......... 165
8 -5.400sp|Q58DX5|NADL2_HUMAN Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 OS=Homo sapiens GN=NAALADL2 PE=1 SV=3  ali   4...................................................KLGKLPLLYKLSSLEKAGFGGVLLYIDPCDLPTVNPSHDTFMVSLNPGGDPSTPGYPSVDESFRQSRSNLTSLLVQPISAPLVAKLISSPKARTKNEACSSLELPNNEIKLKTVTNVVGFVMGLTSPDRYIIVGSHHHTAHSYNGQEWASSTAIITAFIRAL---MSKVKRGWR-----------DRTIVFCSWGGTAFGNIGSYEWGEDFKKVLQKNVVYISLHSPIRGNSSLYPVASPSLQQLVVEKNNFNCTRRAQINHLGVPIVQFA.............................. 292
9 -5.380sp|Q9Y3Q0|NALD2_HUMAN(removed signalp:1-24) N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1  ali   11  14.............................................GKIVIARYGKIFRGNKVKNAMLAGAIGIILYSDPADYFQPYPKGWNLPGTAAQRGNVLNLNGEYTFRLDVEEGVGIPRIPVHPIGYNDAEILLRYLGGIAPPDKSWKRMHVYNINKITRIYNVVGTIRGSVEPDRYVILGGHRDSWVFGAIDPTSGVAVLQEIARS-----GKLMSKGWR-----------RRTIIFASWDAEEFGLLGSTEWAEENVKILQERSIYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKEI................................................ 297
10 -5.380sp|P11388|TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens GN=TOP2A PE=1 SV=3  ali   12  13....................................................YKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAA-LAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGQRKVLFTCFKKVAQLAGSVAEMSSYHHGE--MSLMMTIINLAQNFVGSNNLNLLQPIG--QFGTRLHGGKDS-------------ASPRYIFTMLSSLARLLFPPKDDHTLFLYDDNQRVEPEWYIGIGTGWSCKIPNFDVREIVNNIRRL-MDGEEPLPMLPSY........................... 292

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 4 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.