current user: public

If you have questions about the server, please let us know.

Query: sp|Q9H106|SIRPD_HUMAN(removed signalp:1-29) Signal-regulatory protein delta OS=Homo sapiens GN=SIRPD PE=2 SV=2, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst FHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFVQPCCCLRLLGLTGLLSKLast
1 -86.000sp|Q9H106|SIRPD_HUMAN(removed signalp:1-29) Signal-regulatory protein delta OS=Homo sapiens GN=SIRPD PE=2 SV=2  ali  100  1FHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFVQPCCCLRLLGLTGLLSK 168
2 -55.400sp|Q15116|PDCD1_HUMAN(removed signalp:1-24) Programmed cell death protein 1 OS=Homo sapiens GN=PDCD1 PE=2 SV=3  ali follow..  15  10.PPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKA-QIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVLLGSLVLLVWVLA............... 165
3 -51.100sp|Q5JXA9|SIRB2_HUMAN(removed signalp:1-32) Signal-regulatory protein beta-2 OS=Homo sapiens GN=SIRPB2 PE=2 SV=1  ali follow..  26  8.QVLQPEGPMLVAEGETLLLRCMVVGSCTDGMIKWVKVSTQDQQEIYNFKRGSFPGVMPMIQTSEPLNCDYSIYIHNVTREHTGTYHCVRFDGLSEHSEMKSDEGTSVLVKGAGDPEIIQPQELVLGTTGDTVFLNCTVLGGPPGPIRWFQGAGLSREAIYN...... 174
4 -50.900sp|P10966|CD8B_HUMAN(removed signalp:1-18) T-cell surface glycoprotein CD8 beta chain OS=Homo sapiens GN=CD8B PE=1 SV=1  ali follow..  18  4..LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSP----ELTFGKGTQLSVVDFLPTSTLKKRVCRLPRPETQKGPLCSPI............................ 153
5 -50.700sp|P09564|CD7_HUMAN(removed signalp:1-25) T-cell antigen CD7 OS=Homo sapiens GN=CD7 PE=1 SV=1  ali follow..  19  3.EVQQSPHCTTVPVGASVNITCSTSGG----LRGIYRQLGPQPQDIIYYEDGVVPTTDRRFRGRSGSQDNLTITMHRLQLSDTGTYTCQAITEVN-----VYGSGTLVLVTEEQSQHRCSDAPPRASALPAPPTGSALPQTASALPDPPAASALPAA........... 157
6 -50.600sp|P04206|KV307_HUMAN Ig kappa chain V-III region GOL OS=Homo sapiens PE=1 SV=1  ali follow..  19  2IVLTQSPGTLSLSPGERATLSCRAALLSSRGYLAWYQQKPGQAPRLLMYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSS----PRSFGQGTKVEIK......................................................... 108
7 -50.600sp|A6NJW9|CD8BL_HUMAN(removed signalp:1-18) Putative T-cell surface glycoprotein CD8 beta-2 chain OS=Homo sapiens GN=CD8BP PE=5 SV=2  ali follow..  17  4..LQQTPAYIKVQTNKMVMLSCEAKISLSNMCIYWLRQRQAPSSDSHHEGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSP----ELTFGKGTQLSVVVDFLKSTLKKRVCRLPRPETQKGPLCSPVTLGLLV...................... 160
8 -50.500sp|P01623|KV305_HUMAN Ig kappa chain V-III region WOL OS=Homo sapiens PE=1 SV=1  ali follow..  19  2IVLTQSPGTLSLSPGERATLSCRASQSVSSGYLGWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSL----GRTFGQGTKVEIK......................................................... 108
9 -50.500sp|P18136|KV313_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HIC OS=Homo sapiens PE=2 SV=1  ali follow..  18  2IVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPXDFAVYYCQQYGSS----PWTFGQGTKVEIK......................................................... 108
10 -49.800sp|P01732|CD8A_HUMAN(removed signalp:1-21) T-cell surface glycoprotein CD8 alpha chain OS=Homo sapiens GN=CD8A PE=1 SV=1  ali follow..  14  2.QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAAFLLYLSQNKPKAAEGLDTSGKRLGDTFVLTLSDFRRENEGYYFCSALSNS----IMYFSHFVPVFLPAKPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHAPLAGTCGVLLLSLVIT..... 182
11 -49.400sp|P01620|KV302_HUMAN Ig kappa chain V-III region SIE OS=Homo sapiens PE=1 SV=1  ali follow..  18  2IVLTQSPGTLSLSPGERATLSCRASQSVSNSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPDDFAVYYCQQYGSS----PQTFGQGSKVEIK......................................................... 108
12 -49.000sp|P40259|CD79B_HUMAN(removed signalp:1-28) B-cell antigen receptor complex-associated protein beta chain OS=Homo sapiens GN=CD79B PE=1 SV=1  ali follow..  12  17.RIWQSPRFIARKRGFTVKMHCYMNS--ASGNVSWLWKQEMDENPQQLKLEKGR--------EESQNESLATLTIQGIRFEDNGIYFCQQKCNNTS--EVYQGCGTELRVMGFSTLAQLKNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGL... 171
13 -47.600sp|O95976|IGSF6_HUMAN(removed signalp:1-27) Immunoglobulin superfamily member 6 OS=Homo sapiens GN=IGSF6 PE=2 SV=2  ali follow..  14  3LSVTQPWYLEVDYTHEAVTIKCTFSATSEQPTCLWFRYGAHQPENLCLDGCKSEA--DKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVEARAKQTGGGTTLVVREIKSKELRSFLTALVSLLSVYVTGVCVAF............................ 146
14 -47.600sp|Q96BF3|TMIG2_HUMAN(removed signalp:1-22) Transmembrane and immunoglobulin domain-containing protein 2 OS=Homo sapiens GN=TMIGD2 PE=1 SV=2  ali follow..  17  1LSVQQGPNLLQVRQGSQATLVCQVDQATAWERVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVE--PELEEAEGNITRLFVDPDDPTQNRNRIASFPGFLVGSMGVAAIVAWFWGRRSCQQRDSGNSPGNAFYSNVLYR 176
15 -47.500sp|P01611|KV119_HUMAN Ig kappa chain V-I region Wes OS=Homo sapiens PE=1 SV=1  ali follow..  15  2IQMTQSPSSVSASVGDRVTITCRASQDISHW-LAWYQQKSGKAPKLLIYSASSLENGVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQAHSV----PLTFGGGTTVDIKR........................................................ 108
16 -47.300sp|P01609|KV117_HUMAN Ig kappa chain V-I region Scw OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTQSPSSLSASVGDRVTITCQASQDIRKH-LNWYDQKPGKAPRLLIYGASTLETGVPSRFSGSGSGTDFTLTISTLQPEDIGNYYCQQYDNV----PITFGQGTRVENKG........................................................ 108
17 -47.200sp|P18135|KV312_HUMAN(removed signalp:1-20) Ig kappa chain V-III region HAH OS=Homo sapiens PE=2 SV=1  ali follow..  18  2IVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGTS----PRTFGQGTKVEIK......................................................... 108
18 -47.200sp|P01598|KV106_HUMAN Ig kappa chain V-I region EU OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTQSPSTLSASVGDRVTITCRASQSINTW-LAWYQQKPGKAPKLLMYKASSLESGVPSRFIGSGSGTEFTLTISSLQPDDFATYYCQQYNSD----SKMFGQGTKVEVKG........................................................ 108
19 -47.100sp|P06311|KV311_HUMAN(removed signalp:1-20) Ig kappa chain V-III region IARC/BL41 OS=Homo sapiens PE=1 SV=1  ali follow..  20  4..LTQSPGTLSLSPGESATLSCRASQSVSSN-LAWYQQKRGQSPRLLIRDASSRANGIPDRFSGSGSGTDFTLIISRLEPEDFAVYYCQQYSTS----PYTFGQGTKLEIK......................................................... 107
20 -47.100sp|P01615|KV202_HUMAN Ig kappa chain V-II region FR OS=Homo sapiens PE=1 SV=1  ali follow..  19  4..MTQSPLFLPVTLGEPASIQCRSSQSLGXTYLXWYLQKPGQSPELLIYLSSYRDSGVPDRFSDSGSGTDFTLKITRVQAEDVGVYYCMQATXS----PYTFGQGTKLXIKR........................................................ 113
21 -47.000sp|P01595|KV103_HUMAN Ig kappa chain V-I region Bi OS=Homo sapiens PE=1 SV=1  ali follow..  19  2IQMTQSPSPLSASVGDSVTITCQASQDIRNS-LIWYQQKPGKAPKFLIYDAENLEIGVPSRFRGSGSGTDFALSISSLQPEDFATYYCQQYYNL----PYTFGQGTKLEIK......................................................... 107
22 -47.000sp|P06310|KV206_HUMAN(removed signalp:1-20) Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1  ali follow..  22  4..MTQSPLSLPVTLGQPASISCRSSQSLGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHW----SWTFGQGTKVEIKR........................................................ 113
23 -47.000sp|P80362|KV125_HUMAN Ig kappa chain V-I region WAT OS=Homo sapiens PE=1 SV=1  ali follow..  19  2IQMTQSPSSLSASVGDRVTITCRASQD-ITNYVNWFQQRPGQAPKVLIYGASILETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDTL----PLTFGGGTKVDIK......................................................... 107
24 -46.900sp|P04431|KV123_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Walker OS=Homo sapiens PE=4 SV=1  ali follow..  17  2IQMTQSPSSLSASVGDRVTITCRASQSISNY-LNWYQQKPGKAPKLLIYAASSLQSGVTSRFSGSGSGTDFTLTISSLQPEDSATYYCQQSYST----LITFGQGTRLEIK......................................................... 107
25 -46.900sp|P01617|KV204_HUMAN Ig kappa chain V-II region TEW OS=Homo sapiens PE=1 SV=1  ali follow..  19  4..MTQSPLSLPVTPGEPASISCRSSQSDGFDYLNWYLQKPGQSPXLLIYALSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMXALQA----PITFGQGTRLEIKR........................................................ 113
26 -46.900sp|P01600|KV108_HUMAN Ig kappa chain V-I region Hau OS=Homo sapiens PE=1 SV=1  ali follow..  18  2IQMTQSPSSLSASVGDRVTITCRASQSISSY-LSWYQQKPGKAPQVLIYAASSLPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNYIT----PTSFGQGTRVEIK......................................................... 107
27 -46.800sp|P01597|KV105_HUMAN Ig kappa chain V-I region DEE OS=Homo sapiens PE=1 SV=1  ali follow..  20  2IXMTQSPSSLSASVGDRVTITCRAGQSVNKY-LNWYQQKPGKAPKVLIFAASSLKSGVPSRFSGSGSGTDFTLTISGLLPEDFATYYCQQSYTT----PYTFGPGTKVEMT......................................................... 107
28 -46.800sp|P01625|KV402_HUMAN Ig kappa chain V-IV region Len OS=Homo sapiens PE=1 SV=2  ali follow..  18  2IVMTQSPDSLAVSLGERATINCKSSQSNSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYST----PYSFGQGTKLEIK......................................................... 113
29 -46.800sp|P01622|KV304_HUMAN Ig kappa chain V-III region Ti OS=Homo sapiens PE=1 SV=1  ali follow..  19  3.VLTQSPGTLSLSPGERATLSCRASQSVSNSFLAWYQQKPGQAPRLLIYVASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPS----TFGQGTKVELK......................................................... 108
30 -46.800sp|P01604|KV112_HUMAN Ig kappa chain V-I region Kue OS=Homo sapiens PE=1 SV=1  ali follow..  18  2IQMTQSPSTQPASVGDRVTITCRASQSI-NIWLAWYQQKPEKAPKLLIYKASTLETGVPSRFSGSGSGTEFTLTINSLQPDDFATYYCQQYSRY----PYTFGQGTKLDIK......................................................... 107
31 -46.800sp|P01607|KV115_HUMAN Ig kappa chain V-I region Rei OS=Homo sapiens PE=1 SV=1  ali follow..  19  2IQMTQSPSSLSASVGDRVTITCQASQDIIKY-LNWYQQTPGKAPKLLIYEASNLQAGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSL----PYTFGQGTKLQIT......................................................... 107
32 -46.700sp|P01605|KV113_HUMAN Ig kappa chain V-I region Lay OS=Homo sapiens PE=1 SV=1  ali follow..  19  2IQMTQSPSSLSVSVGDRVTITCQASQNVNAY-LNWYQQKPGLAPKLLIYGASTREAGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYNNW----PPTFGQGTKVEVK......................................................... 107
33 -46.700sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1  ali follow..  20  2IVLTQSPLSLPVTPGEPASISCRSSQNLLXSXLDWYLXKPGXSPXLLIYLGSNRASGVPNRFSGSGSGTXFTLKISRVXAXXVGVYYCMQALQT----PLTFGGGTNVEIKR........................................................ 112
34 -46.700sp|P01614|KV201_HUMAN Ig kappa chain V-II region Cum OS=Homo sapiens PE=1 SV=1  ali follow..  21  3IVMTQTPLSLPVTPGEPASISCRSSQSLGNTYLNWYLQKAGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVQAEDVGVYYCMQRLEI----PYTFGQGTKLEIR......................................................... 114
35 -46.600sp|P01599|KV107_HUMAN Ig kappa chain V-I region Gal OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTQSPSSLSASVGDRVTIICRASQGI-RNDLTWYQQKPGKAPKELIYAASNLQSGVPSRFSGSGAGTEFTLTISSLQPEDFATYYCLQQNSY----PRSFGQGTKVEIK......................................................... 107
36 -46.600sp|P01624|KV306_HUMAN Ig kappa chain V-III region POM OS=Homo sapiens PE=1 SV=1  ali follow..  19  2IVMTQSPVTLSVSPGERATLSCRASQSISNSYLAWYQQKPSGSPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPP----TFGQGTRVEIK......................................................... 108
37 -46.600sp|P04432|KV124_HUMAN(removed signalp:1-22) Ig kappa chain V-I region Daudi OS=Homo sapiens PE=4 SV=1  ali follow..  17  2IQMTQSPSSLSASVGDRVTITCRAGHNITNF-LSWYQQKPGKAPTLLIYAVSNLQVGVPSRFSGSGSGAEFTLTISSLQPEDFATYYCQQNYNF----SFTFGGGTKVDNK......................................................... 107
38 -46.500sp|P01608|KV116_HUMAN Ig kappa chain V-I region Roy OS=Homo sapiens PE=1 SV=1  ali follow..  18  2IQMTQSPSSLSASVGDRVTITCQASQDI-SIFLNWYQQKPGKAPKLLIYDASKLEAGVPSRFSGTGSGTDFTFTISSLQPEDIATYYCQQFDNL----PLTFGGGTKVDFK......................................................... 107
39 -46.500sp|P01603|KV111_HUMAN Ig kappa chain V-I region Ka OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTQSPSTLSVSVGDRVTITCEASQTVLSY-LNWYQQKPGKAPKLLIYAASSLETGVPSRFSGQGSGTXFTFTISSVXPXXFATYYCQXYLDLP----RTFGQGTKVDLK......................................................... 107
40 -46.500sp|P01610|KV118_HUMAN Ig kappa chain V-I region WEA OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTQSPSSLSASVGDRVTITCRASQG-IRNDLTWYQQKPGTAPKRLIYGATSLQSGVPSRFSGSGSGTEFTLTINSLQPEDFATYYCLQYSSF----PWTFGQGTKVEVK......................................................... 107
41 -46.400sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS=Homo sapiens PE=1 SV=1  ali follow..  18  2IQMTQSPSSLSASVGDRVTITCQASQDINHY-LNWYQQGPKKAPKILIYDASNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTL----PRTFGQGTKLEIK......................................................... 107
42 -46.400sp|P01619|KV301_HUMAN Ig kappa chain V-III region B6 OS=Homo sapiens PE=1 SV=1  ali follow..  15  2IVLTXSPGTLSLSPGXRAALSCRASQSLSGNYLAWYQQKPGQAPRLLMYGVSSRATGIPDRFSGSGSGADFTLTISRLXPEDFAVYYCQQYGSS----PFTFGQGSKLEIK......................................................... 108
43 -46.300sp|P01594|KV102_HUMAN Ig kappa chain V-I region AU OS=Homo sapiens PE=1 SV=1  ali follow..  16  2IQMTQSPSSLSASVGDRVTITCQASQDISDY-LNWYQQKPGKAPKLLIYDASNLESGVPSRFSGGGSGAHFTFTISSLQPEDIATYYCQQYDYL----PWTFGQGTKVEIK......................................................... 107
44 -46.200sp|P06309|KV205_HUMAN Ig kappa chain V-II region GM607 (Fragment) OS=Homo sapiens PE=4 SV=1  ali follow..  20  7.VMTQSPLSLPVTPGEPASISCRSSQSNGYNYLDWYLQKPQQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGLQT----PQTFGQGTKVEIK......................................................... 116
45 -46.200sp|P01612|KV120_HUMAN Ig kappa chain V-I region Mev OS=Homo sapiens PE=1 SV=1  ali follow..  21  2VQMTQSPSSLSASVGDRVIITCRASQSSVDY-LNWYQQKPGKAPKLLIFDTSNLQSGVPSRFSGGRSGTDFTLTISSLQPDDFATYYCQQSYTNP---EVTFGGGTTVDIK......................................................... 108
46 -46.200sp|O14931|NCTR3_HUMAN(removed signalp:1-18) Natural cytotoxicity triggering receptor 3 OS=Homo sapiens GN=NCR3 PE=1 SV=1  ali follow..  20  1LWVSQPP-EIRTLEGSSAFLPCSFNGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLG---LGVGTGNGTRLVVEKEHPQLGAGTVLLLR-AGFYAVSFLSVA----VGSTVYYQGKC.............. 148
47 -46.100sp|P04430|KV122_HUMAN Ig kappa chain V-I region BAN OS=Homo sapiens PE=1 SV=1  ali follow..  22  2IQLTQSPSSLSASVGDRVTITCRASQSVYNY-VAWFQQKPGKAPKSLIYDASTLQSGVPSNFTGSGSGTDFILTISSLQPEDFATYYCQQYNSY----PYTFGQGTKVQIK......................................................... 107
48 -46.000sp|P06314|KV404_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region B17 OS=Homo sapiens PE=2 SV=1  ali follow..  18  2IVMTQSPDSLAVSLGERATINCKSSQSINKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYNL----PWTFGQGTKVEIK......................................................... 113
49 -46.000sp|P01596|KV104_HUMAN Ig kappa chain V-I region CAR OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTQSPSTLSASVGDRVAITCRASQNISSW-LAWYQQKPGKAPKVLIYKSSSLESGVPSRFSGSGSGTDFTLTISSLXPXXFATYYCQQYNT-----FFTFGPGTKVDIK......................................................... 106
50 -45.900sp|P06889|LV405_HUMAN Ig lambda chain V-IV region MOL OS=Homo sapiens PE=1 SV=1  ali follow..  19  1YELTQPP-SVSVSPGQTATISCSGDKL-GESYYDWYQQSPGQSPLLVIYEGDKRPSGIPXRFSGSNSGNTATLTISGTESMDEADYYCQAWNSS----SVLFGGGTKLTVLG........................................................ 106
51 -45.800sp|P03979|TVC_HUMAN(removed signalp:1-17) T-cell receptor gamma chain V region PT-gamma-1/2 OS=Homo sapiens GN=TRGV3 PE=2 SV=1  ali follow..  20  4.NLEGRTKSVTRQTGSSAEITCDLTVT-NTFYIHWYLHQEGKAPQRLLYYDVSTARDPGKYYTHTPRRWSWILRLQNLIENDSGVYYCATWDRXKNYYKKLFGSGTTLVVT......................................................... 119
52 -45.700sp|P80748|LV302_HUMAN Ig lambda chain V-III region LOI OS=Homo sapiens PE=1 SV=1  ali follow..  18  2..VLTQPPSVSVAPGETARLTCGGNDI-GSESVHWYQQKPGQAPVLVIYFDRDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQLWDSSSE--HVVFGGGTKLTVLSQPK..................................................... 111
53 -45.700sp|P01716|LV402_HUMAN Ig lambda chain V-IV region X OS=Homo sapiens PE=1 SV=1  ali follow..  16  1YDLTQPP-SVSVSPGQTASITCSGDKL-GDKDVCWYQQRPGQSPVLVIYQDNQRSSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSM----SVVFGGGTRLTVLS........................................................ 106
54 -45.500sp|P01606|KV114_HUMAN Ig kappa chain V-I region OU OS=Homo sapiens PE=1 SV=1  ali follow..  17  2IQMTXSPSSLSASVGXRVTITCRASXTISSY-LXWYXXKPGKAPXLLIYAASXLHSGVPSRFSGSGSGTXFTFTISSLXPXXFATYYCXXSYSS----PTTFGXGTRLXIK......................................................... 107
55 -45.200sp|P01717|LV403_HUMAN Ig lambda chain V-IV region Hil OS=Homo sapiens PE=1 SV=1  ali follow..  20  2YELTQPP-SVSVSPGQTARITCSANAL-PNQYAYWYQQKPGRAPVMVIYKDTQRPSGIPQRFSSSTSGTTVTLTISGVQAEDEADYYCQAWDNS----ASIFGGGTKLTVLG........................................................ 107
56 -45.100sp|P01715|LV401_HUMAN Ig lambda chain V-IV region Bau OS=Homo sapiens PE=1 SV=1  ali follow..  18  1YGLTQPP-SLSVSPGQTASITCSGDKL-GEQYVCWYQQKPGQSPVLVIYHDSKRPSGIPERFSGSNSGTTATLTISGTQAMDEADYYCQAWDSY----TVIFGGGTKLTVLG........................................................ 106
57 -44.900sp|P01737|TVA3_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region PY14 OS=Homo sapiens PE=1 SV=1  ali follow..  17  2.SVTQLGSHVSVSEGALVLLRCNYSSSVPPY-LFWYVQYPNQGLQLLLKYTSAATL-NGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSDLNSSASKIIFGSGTRLSIR......................................................... 115
58 -44.900sp|P04436|TVA1_HUMAN(removed signalp:1-20) T-cell receptor alpha chain V region HPB-MLT (Fragment) OS=Homo sapiens PE=2 SV=1  ali follow..  14  2.KVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQ-GRYSWNFQKSTSSFNFTITASQVVDSAVYFCAL---DSSASKIIFGSGTRLSIR......................................................... 111
59 -44.800sp|P04435|TVB2_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region CTL-L17 OS=Homo sapiens GN=TCRB PE=2 SV=1  ali follow..  14  2..VSQNPRHNITKRGQNVTFRCDPISE--HNRLYWYRQTLGQGPEFLTYFQNKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLAGLNQPQH-FGDGTRLSI.......................................................... 111
60 -44.700sp|P16410|CTLA4_HUMAN(removed signalp:1-37) Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens GN=CTLA4 PE=1 SV=3  ali follow..  14  1MHVAQ-PAVVLASSRGIASFVCEYASPGKATRVTVLRQADSQVTEVCAATYMMGNELDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCP--DSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPT 170
61 -44.600sp|P01718|LV404_HUMAN Ig lambda chain V-IV region Kern OS=Homo sapiens PE=1 SV=1  ali follow..  19  1YALTQPP-SVSVSPGQTAVITCSGDNL-EKTFVSWFQQRPGQSPLLVIYHTSERPSEIPERFSGSSSGATATLTISGAQSVDEADYFCQTWDTI----TAIFGGGTKLTVLS........................................................ 106
62 -44.500sp|P01719|LV501_HUMAN Ig lambda chain V-V region DEL OS=Homo sapiens PE=1 SV=1  ali follow..  16  2..VLSQPPSVSVAPGQTARITCGGDGI-GGKSVHWYQQKPGQAPVLVVHEDNDRPAGIPERFSGSNSGNTAALTISRVEAGDEADYYCEVWDDRTA--HVVFGGGTKLTVLG........................................................ 108
63 -44.500sp|P04207|KV308_HUMAN(removed signalp:1-20) Ig kappa chain V-III region CLL OS=Homo sapiens PE=1 SV=2  ali follow..  19  2IVMTQSPATLSVSPGERATLSCRASQSVSNN-LAWYQQKPGQPPRLLIYGASTRATGIPARFSGSGSGTEFTLTISRLQSEDFAVYYCQQYNNWPPW---TFGQGTRVEIK......................................................... 108
64 -44.200sp|P06313|KV403_HUMAN(removed signalp:1-20) Ig kappa chain V-IV region JI OS=Homo sapiens PE=4 SV=1  ali follow..  18  2IVMTQSPDSLAVSLGERATINCKSSQSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYDTIP-----TFGGGTKVEIK......................................................... 112
65 -44.200sp|P01713|LV210_HUMAN Ig lambda chain V-II region NIG-58 OS=Homo sapiens PE=1 SV=1  ali follow..  19  3..ALTQPRSVSGSPGQSLTISCSGAPCDGCESVSWYQQHPGKAPKLIIYGFSNRPSGVPLRFSGSKSGDAASLTISGLQVEDEADYYCSSYADS----SVIFGAGTKLTVLR........................................................ 110
66 -44.100sp|P01700|LV102_HUMAN Ig lambda chain V-I region HA OS=Homo sapiens PE=1 SV=1  ali follow..  19  3..VLTQPPSVSGTPGQRVTISCSGGSSTGNNYVYWYQQLPGTAPKLLIYRDDKRPSGVPDRFSGSKSGTSASLAISGLRSEDEAHYHCAAWDYRLS--AVVFGGGTQLTVLR........................................................ 112
67 -44.000sp|P01613|KV121_HUMAN Ig kappa chain V-I region Ni OS=Homo sapiens PE=1 SV=1  ali follow..  16  2IQMTQSPSSLSATVGDRVTLLCEASQESGNTFLAWYQQKPKKAPKLLIYDASNLETGVPSRFSESGSGTDFTFTISGLXPXXFAVYYCQXYDTLPS----TFGVASKVESK......................................................... 111
68 -43.900sp|P06887|LV108_HUMAN Ig lambda chain V-I region MEM OS=Homo sapiens PE=1 SV=1  ali follow..  21  3..VLTQPPSASGTPGGRVTISCSGSSSNSNXPAYWYQQLPGTAPKLLIYNYNQRPSGVPDRFSASRSGTSASLAISGLQSEDEADYYCAAWDDSLD--GYVFGTGTKVTVLR........................................................ 112
69 -43.900sp|P01733|TVB1_HUMAN(removed signalp:1-21) T-cell receptor beta chain V region YT35 OS=Homo sapiens GN=TRBV12-3 PE=1 SV=1  ali follow..  17  2..VIQSPRHEVTEMGQEVTLRCKPISG--HNSLFWYRQTMMRGLELLIYFNNNSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSFSTSANYGYTFGSGTRLTVV......................................................... 114
70 -43.700sp|P80422|LV212_HUMAN Ig gamma lambda chain V-II region DOT OS=Homo sapiens PE=1 SV=1  ali follow..  17  2.SALTQPRSLSGSPGQAVTISCTGLPSDDDNFVSWYQQTPGRAPRLLIYDDSLRPSGVPNRFSGSKSDTKAALTISGLQPDDEATYFCCSYVGNY---IFVFGQGTDLTVLG........................................................ 111
71 -43.500sp|P04209|LV211_HUMAN Ig lambda chain V-II region NIG-84 OS=Homo sapiens PE=1 SV=1  ali follow..  19  3..ALTQPASVSGSPGQSITISCTGTTSGGYDFVSWYQQHPGKAPKLLIYDVNSRPSGISNRFSGSKSGNTASLTISGLQAEDEADYYCSSFTTTNS--RAVFGGGTKLSVLG........................................................ 112
72 -43.400sp|P06888|LV109_HUMAN Ig lambda chain V-I region EPS OS=Homo sapiens PE=1 SV=1  ali follow..  19  3..VLTQPPSLSAAPGQRVSISCSGSSNIGKNYVDWYQQLPGTAPKLLIFNNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEAIYYCGTWDNR----RSVFGGGTNVTVVG........................................................ 109
73 -43.300sp|P04208|LV106_HUMAN Ig lambda chain V-I region WAH OS=Homo sapiens PE=1 SV=1  ali follow..  18  3..VLTQPPSASGTPGQRVTISCFGSSNIGRYYVYWYQQLPGTTPKLLIYKDNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDS----LWVFGGGTTLTVLS........................................................ 109
74 -43.300sp|P01711|LV208_HUMAN Ig lambda chain V-II region VIL OS=Homo sapiens PE=1 SV=1  ali follow..  21  4..LTQPA-SVSGSLGQSITISCTGTSSDGYNYVSWFQQHPGTAPKLIISEVRNRPSGVSDRFSGSKSANTASLTISGLQAEDEADYYCSSYTSSN---SVVFGGGTKLTVLG........................................................ 111
75 -43.200sp|P01701|LV103_HUMAN Ig lambda chain V-I region NEW OS=Homo sapiens PE=1 SV=1  ali follow..  19  3..VLTQPPSVSAAPGQKVTISCSGGSNIGNNYVSWHQHLPGTAPKLLIYEDNKRPSGIPDRISASKSGTSATLGITGLRTGDEADYYCATWDSSLN--AVVFGGGTKVTVLG........................................................ 111

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.