current user: public

If you have questions about the server, please let us know.

Query: sp|Q9H3H1|MOD5_HUMAN tRNA dimethylallyltransferase, mitochondrial OS=Homo sapiens GN=TRIT1 PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .
# Score Template Links and tools%idFirst MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVYEGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKPQEMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVLEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSVLast
1 -128.000sp|Q9H3H1|MOD5_HUMAN tRNA dimethylallyltransferase, mitochondrial OS=Homo sapiens GN=TRIT1 PE=1 SV=1  ali  100  1MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVYEGLDIITNKVSAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKPQEMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIFQSIGFKEFHEYLITEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVSDVSKWEESVLEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV 467
2 -14.700sp|O00488|ZN593_HUMAN Zinc finger protein 593 OS=Homo sapiens GN=ZNF593 PE=1 SV=2  ali follow..  12  48.............................................................................................................................................................................................................................................................................................................................................................................................NAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTS 133
3 -14.200sp|Q96KR1|ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens GN=ZFR PE=1 SV=2  ali   14  187.....................................................................................................................................................................................................................................................................................................................................................................KISCAGPQTYKEHLEGQKKASQNTSSSNSSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPIPSTEPNVVSQATSSTAVSASKPTASPSS...... 298
4 -12.200sp|Q16854|DGUOK_HUMAN Deoxyguanosine kinase, mitochondrial OS=Homo sapiens GN=DGUOK PE=1 SV=2  ali follow..  14  28............SSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFLKVQLEPFPEKLLQARKPVQIFERSVYSDRYIF-------------AKNLFENGSLSDIEWHIYQDWHSFLLWEFASRITLH--------------------------------------------GFIYLQASPQVCLKRLYQR-EKGIELAYLEQLHGQHEAWLIHKTTKLHFEALMNI----------PVLVLDVNDDFSEEVTKQEDLMREVNTFVKNL.................................................................................................................................................. 277
5 -12.200sp|Q5T6J7|GNTK_HUMAN Probable gluconokinase OS=Homo sapiens GN=C9orf103 PE=2 SV=1  ali follow..  16  2....................AAPGALLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIP------------------WLCNLHDILLRDVASGQRVVLACSA-----------------------------------------------------------LKKTYR--DILTQGKDGVALKCEESGKEAKQAEM-------QLLVVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLE.............................................................................................................................................................................................................. 156
6 -12.100sp|Q9UPR6|ZFR2_HUMAN Zinc finger RNA-binding protein 2 OS=Homo sapiens GN=ZFR2 PE=2 SV=3  ali   16  127.....................................................................................................................................................................................................................................................................................................................................................................KISCAGPQTYREHLGGQKAAQKTGVQPNGSPRGVQAQLHCDLCAVSCTGADAYAAHIRGSKHQKVFKLHAKLGKPIPTLEPALATESPPGAEAKPTSPTGPSVCASSRP. 240
7 -11.900sp|Q9HA47|UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens GN=UCK1 PE=1 SV=1  ali follow..  15  1MASAGGEDCESPAPEADRPHQRPFLIGVSGGTASGKSTVCEKIMELLGQNILSQDR--FYKVLTYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVLFEGILVFYSQEI------------------------------RDMFHLRLFVDTDSDVRL----SRRVLRDVRRGRDLEQILTQYTT--FVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILNGDICKWHRGGSN.............................................................................................................................................................................................................. 244
8 -11.400sp|Q7Z570|Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens GN=ZNF804A PE=1 SV=3  ali   12  8..........................................................................................................................................................................................................................................................................................................................................................ISSTHLSNGHFNIKGVFRGPLSKNGNKTLDYAEKENTIAKALEDLKANFYCELCDKQYYKHQEFDNHINSYDHAHKQRLKELKQREFARNVASKSRKDERKQEKALQRLHKLAELRKETV. 128
9 -11.400sp|A4D1E1|Z804B_HUMAN Zinc finger protein 804B OS=Homo sapiens GN=ZNF804B PE=1 SV=2  ali   17  42.............................................................................................................................................................................................................................................................................................................................................................................................KSTAKALEDVKANFYCELCDKQYHKHQEFDNHINSYDHAHKQRLKELKQREFARNVASKSWKDEKKQEKALKRLHQLAELRQQSE. 126
10 -11.400sp|Q9BZX2|UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens GN=UCK2 PE=1 SV=1  ali follow..  17  1...MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNILSQDS--FYRVLTFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEV------------------------------RDLFQMKLFVDTDADTRL----SRRVLRDIS---ERGRDLEQILSQTFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNG......................................................................................................................................................................................................................... 231
11 -11.000sp|Q96KR1|ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens GN=ZFR PE=1 SV=2  ali   10.....................................................................................................................................................................................................................................................................................................................................................................................KKAPFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTSSSNSSTRGTQNTGADAYAAHIRGAKHQKVVKL.. 112
12 -11.000sp|Q5T481|RBM20_HUMAN Probable RNA-binding protein 20 OS=Homo sapiens GN=RBM20 PE=1 SV=3  ali   23  244.........................................................................................................................................................................................................................................................................................................................................................................LQAHELNDF-HGVAPLHLP--------------HICSICDKKVFDLKDWELHVKGKLHAQKCLVFSENAG.................................... 298
13 -10.600sp|Q9H2Y7|ZF106_HUMAN Zinc finger protein 106 homolog OS=Homo sapiens GN=ZFP106 PE=1 SV=1  ali   17  6............................................................................................................................................................................................................................................................................................................................................................................................IECPSSPSFPRDISHECRVCGVTEVGLSAYAKHISGQLHKDNVDAQEREDDGKGEEEEEDYFDKELIQLIKQRKEQSRQDEPSNSN. 91
14 -10.600sp|Q9UPR6|ZFR2_HUMAN Zinc finger RNA-binding protein 2 OS=Homo sapiens GN=ZFR2 PE=2 SV=3  ali   13  145...................................................................................................................................................................................................................................................................................................................................................................................SDAQPVGPEYVEEVFSDEGRVLRFHCKLCECSFNDLNAKDLHVRGRRHRLQYRKKVNPDLPIATEPSSRARKVLEERMRKQRHLAEERLEQLR... 237
15 -10.600sp|Q9UDW3|ZMAT5_HUMAN Zinc finger matrin-type protein 5 OS=Homo sapiens GN=ZMAT5 PE=1 SV=1  ali follow..  21  3........................................................................................................................................................................................................................................................................................................................................................................................................KRYFCDYCDRSFQDNLH-KKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRK................... 59
16 -10.400sp|P27707|DCK_HUMAN Deoxycytidine kinase OS=Homo sapiens GN=DCK PE=1 SV=1  ali follow..  11  1MAT--PPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNV-YEKPERWSFTFQTYIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIF-------------ASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELD--------------------------------------------GIIYLQATPETCLHRIYLREEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEV----------PILTLDVNEDFKDKYESLVEKVKEFLST...................................................................................................................................................... 259
17 -10.400sp|Q15911|ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2  ali   10  66.............................................................................................................................................................................................................................................................................................................................................................................................GGGGGGGGGGGGSYHCLACESALCGEEALSQHLESALHKHRTITRAARNAKEHPSLLPHSACFPDPSTASTSQSAAHSNDSPPPP. 150
18 -10.300sp|Q9H898|ZMAT4_HUMAN Zinc finger matrin-type protein 4 OS=Homo sapiens GN=ZMAT4 PE=2 SV=1  ali follow..  12  2..............................................................................................................................................................................................................................................................................................................................................................................................KSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKN............ 74
19 -10.300sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4  ali   12  41...................GSSFKAALLSGPPGVGKTTTASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIKGFIMDEVDGMAGN------DRGGIQELIGLIKHTKIPIICMCNDRNIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEI-----ILGANQDIRQVLHNLSMWCARSKALTY--DQAKADSHRAKKDIKMGPFDVARKVFAAGEETAHMSLVDKSDSIAPLFVQENYIHV................................................................................................................................................................................................................ 292
20 -10.300sp|Q9C0A1|ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sapiens GN=ZFHX2 PE=2 SV=3  ali   93........................................................................................................................................................................................................................................................................................................................................................................................................CTYHCLACEVLLSGREALASHLRSSAHRRKAAPPQGGPPISITNAATAASAAVAFAKEEARLPHTDSNPKTTTT. 166
21 -10.300sp|Q9HA38|ZMAT3_HUMAN Zinc finger matrin-type protein 3 OS=Homo sapiens GN=ZMAT3 PE=1 SV=1  ali follow..  14  225.....................................................................................................................................................................................................................................................................................................................................................................................NPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMEN................................. 285
22 -10.200sp|Q14966|ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens GN=ZNF638 PE=1 SV=2  ali   19  128..........................................................................................................................................................................................................................................................................................................................................................................................................FFCPICSLFYSGEKAMTNHCKSTRHKQNTEKFMAKQRKEKEQNEAEERSSR...................... 178
23 -10.100sp|Q15911|ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2  ali   10  213..........................................................................................................................................................................................................................................................................................................................................................................................SGGGGGGGGGGGGGGSYHCLACESALCGEEALSQHLESALHKHRTITRAARNAKEHPSLLPHSACFPDPSTASTSQSAAHSND...... 295
24 -9.930sp|Q5SY16|NOL9_HUMAN Polynucleotide 5`-hydroxyl-kinase NOL9 OS=Homo sapiens GN=NOL9 PE=1 SV=1  ali   1........................VILVCGSQDVGKSTFNRYLINH----LLNSLPCVDYLECDLGQTEFTPHLRTPQKMVYYGKPSCKN---NYENYIDIVKYVFSAY--KRESPLIVNTMGW-----------------------------VSDQGLLLLIDLIRLLSPSHVVQFRSDHSKYM.......................................................................................................................................................................................................................................................................................... 142
25 -9.920sp|O00142|KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens GN=TK2 PE=1 SV=4  ali follow..  12  40............PPDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEVLT---------------EPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIF---------------------------VENLYRSMPEVDYVVLSEWFDWILRNMDVSVDL----------------------------------IVYLRTNPETCYQRLKKREEKVIPLEYLEAIHHLHEEWLIKGSL---------------FPMAAPVLVIEADHHMERMLELFEQNRDRILTPENR................................................................................................................................................... 261
26 -9.790sp|Q5SY16|NOL9_HUMAN Polynucleotide 5`-hydroxyl-kinase NOL9 OS=Homo sapiens GN=NOL9 PE=1 SV=1  ali   136.........EELVNVSCEEVDGCPVILVCGSQDVGKSTFNRYLINH----LLNSLPCVDYLECDLGQTEFTPHLRTPQKMVYYGKPSCKN---NYENYIDIVKYVFSAY--KRESPLIVNTMG-WVSDQ----------------------------GLLLLIDLIRLLSPSHVVQFRSDHSKYMPDLTPQY................................................................................................................................................................................................................................................................................... 299
27 -9.640sp|Q8IYQ7|THNS1_HUMAN Threonine synthase-like 1 OS=Homo sapiens GN=THNSL1 PE=1 SV=2  ali   12  58.........................IILMGPPGAGKTTVGRIIGQKLGCCVIDVDDDIL-------------EKTWNMS--VSEKLQDVGNEQ----FLEEEGKAVLNFSASGSVISLTGSN-VYLDVPLLDLICRLKLMKTDRIVGQNSGTSMKDKFRRQYYKKWYDARVFCESGASPEEADKVLNAIK..................................................................................................................................................................................................................................................................................... 221
28 -9.630sp|Q9UL40|ZN346_HUMAN Zinc finger protein 346 OS=Homo sapiens GN=ZNF346 PE=1 SV=1  ali follow..  13  223..........................................................................................................................................................................................................................................................................................................................................................................................GRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPMQRQPIQKDSTTLED................. 294
29 -9.610sp|Q9Y3D8|KAD6_HUMAN Adenylate kinase isoenzyme 6 OS=Homo sapiens GN=TAF9 PE=1 SV=1  ali follow..  16  2.....................LLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDLRTDTNVLYERLETRGYNEKKLTDN---IQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE......................................................................................................................................................................................................................................................................................................... 164
30 -9.520sp|Q9NWW6|NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens GN=NRK1 PE=1 SV=1  ali follow..  12  2.....................KTFIIGISGVTNSGKTTLAKNLQKHLNCSVISQDD--FFKPES----EIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEELIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQE................................................................................................................................................................................................................................................................................................ 157
31 -9.280sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens GN=CHTF18 PE=1 SV=1  ali   12  64...................RPKQKVALLCGPPGLGKTTLAHVIARHAGYSVVEMNASD--RSPEVFRTRIEADEIDGAP-SILNRKGPQEVGPQGPAVPSGGGRRRRAEGGLLMRPIICICNDQFLRQLKQQAFLLHFPPTLPSRLVQRLQEVSLRQGMRADPGVLAAL------EKTDNDIRACINTLQFLYSRGQRELS.......................................................................................................................................................................................................................................................................... 268
32 -9.280sp|P09234|RU1C_HUMAN U1 small nuclear ribonucleoprotein C OS=Homo sapiens GN=SNRPC PE=1 SV=1  ali follow..  10  3.........................................................................................................................................................................................................................................................................................................................................................................................................KFYCDYCDTYLTHDSP-KTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMI. 77
33 -9.150sp|Q9ULV3|CIZ1_HUMAN Cip1-interacting zinc finger protein OS=Homo sapiens GN=CIZ1 PE=1 SV=2  ali   12  199..........................................................................................................................................................................................................................................................................................................................................................................................................YICRICHKFYHSNSG-LSHCKSLGHFENLQKYKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPN. 271
34 -9.140sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2  ali   16  166.........................VLLRGPPGCGKTTVVAAACSHLGLHLLKVPCSSL-----------------------------------CAESSGAVETKLQAIFSRAR-PAVL----------------------------------------------LTAVDLLGRDRDGLGEDARVMAVLRHLLLN-------------------EDPLNSCPPLMVVATTSRAQDLPADVQTAFPHELEVPALSEGQ.................................................................................................................................................................................................................. 300

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.