current user: public

If you have questions about the server, please let us know.

Query: sp|Q9H816|DCR1B_HUMAN 5` exonuclease Apollo OS=Homo sapiens GN=DCLRE1B PE=1 SV=1, from H.sapiens

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530
# Score Template Links and tools%idFirst MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPCLast
1 -122.000sp|Q9H816|DCR1B_HUMAN 5` exonuclease Apollo OS=Homo sapiens GN=DCLRE1B PE=1 SV=1  ali  100  1MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC 532
2 -73.100sp|Q96SD1|DCR1C_HUMAN Protein artemis OS=Homo sapiens GN=DCLRE1C PE=1 SV=2  ali   29  4FEGQMAEYPTISIDRFDREN-LRARAYFLSHCHKDHMKGLRAPTKVYLYCSPVTKELLLTKYRFWKKRIISIEIETPTQISLVDEASEEIVVTLLPAGHCPGSVMFLFQGNNGTVLYTGDFRLAQGEAARMELLHSKDIQSVYLDTTFCDPRYQIPSREECLSGVLELVRSWYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLD--MFRNMPEILHHLTTDRNTQIHACQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRK......................................................................................................................................................................................................................................................................... 300
3 -69.800sp|Q6PJP8|DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens GN=DCLRE1A PE=1 SV=3  ali   37  105...KKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAGLSKHFTFPVYCSEITGNLLKNKLHVQEQYIHPLPLDTECIV-------NGVKVVLLDANHCPGAVMILFYLPNTVILHTGDFRADPSMERSLLA--DQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAPHALVVCGTYSIGKEKVFLAIADVLGSKVGM......................................................................................................................................................................................................................................................................................................................................... 300
4 -65.700sp|Q6PJP8|DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens GN=DCLRE1A PE=1 SV=3  ali   32  1.................................................CSEITGNLLKNKLHVQEQYIHPLPLDTECIV-------NGVKVVLLDANHCPGAVMILFYLPNGVILHTGDFRADPSMERSL--LADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIPEIITTDMCSSLVHLLPMMQINFKGLQSHGKYNQILAFRPTGWTHTKGNISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTWKSRS................................................................................................................................................................................................................................. 275
5 -40.900sp|Q96SD1|DCR1C_HUMAN Protein artemis OS=Homo sapiens GN=DCLRE1C PE=1 SV=2  ali   15  7........................................................................................................................................KDIQSVYLDTTFCDPRFQIPSREECLSGVLELVRSWITRSWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRN-MPEILHHLTTDRNTQIHACRQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRSSYRACFSFHSSYSEIKDFLSYLCPVNAYPNVIPVGTTMDKVVEILKPLCRSSQSTEPKYKPLGKLKR---ARTVHRDSEEEDDYLFDDPLPIPLRHKVPYPETFHPEVFSMTAVSEKQPEKLRQTPGCCRAECMQSSRFTNF........................................................................................................................... 299
6 -26.800sp|Q5TA45|INT11_HUMAN Integrator complex subunit 11 OS=Homo sapiens GN=CPSF3L PE=1 SV=2  ali follow..  13  24.....IAGKNVMLDC----LTDFLDCVIISHFHLDHCGALMVGYDGPIYMTHPTQAICSQMIKDCMKKVVAVHLHQTVQV------DDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIR--DSKRCRERDFLKKVHETVERKVLIPVFALGRQELCILLETNLKVPIYFSTKANHYYKLFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRMSFSAHADAKGIMQLVGQAEPESVLLVHGEKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPR............................................................................................................................................................................ 477
7 -25.300sp|Q9UKF6|CPSF3_HUMAN Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens GN=CPSF3 PE=1 SV=1  ali   18  32.....FKGRKIMLDCIDLIDPAEIDLLLISHFHLDHCGALKTSFKGRTFMTHATKAIYRWLLSDYVKVIETINFHEVKEV-------AGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIPNIKPDILIIESTYGTHIH--EKREEREARFCNTVHDIVNRRGLIPVFALGRAQELLLILDEYDIPIYYAS....................................................................................................................................................................................................................................................................................................................................... 272
8 -24.100sp|Q6PJP8|DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens GN=DCLRE1A PE=1 SV=3  ali   36  255...KKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAGLSKHFTFPVY................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 300
9 -19.200sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2  ali   16  25.....VDEFRFLLDC--RKHVHQIDAVLLSHPDPLHLGALKLGLNCAIYATIPVYKM-LDDVDAAFDKIQQLKFSQIVNLK---GKGHGLSITPLPAGHMIGGTIWKIVKDGEEIVYAVDFHKREIHLNGCSLEMLSRPSLLITDSFNATYVQ--PRRKQRDEQLLTNVLETLRGNVLIAVDTAGRVLELAQLLDQIWRTKDAGLGVYSLA................................................................................................................................................................................................................................................................................................................................. 267
10 -18.200sp|Q9UKF6|CPSF3_HUMAN Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens GN=CPSF3 PE=1 SV=1  ali   16  1...........................................................................................FWCYHAGHVLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIPNIKPDILIIESTYGTHIH--EKREEREARFCNTVHDIVNRRGLIPVFALGRAQELLLILDEYDIPIYYAS-AKKCMAVYQTYVNAMNDKIRKQINI--KHISNLKSMDHFDDIGPSVVMASPGMMQSGLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGEQNEMA................................................................................................................................................................................................................................... 275
11 -16.200sp|Q96SD1|DCR1C_HUMAN Protein artemis OS=Homo sapiens GN=DCLRE1C PE=1 SV=2  ali   13  6......................................................................................................................................................................................................................................................................RTGESSYRACFSFHSSYSEIKDFLSYLCPVNAYPNVIPVGTT----------------DKVVEILKPLCRSSQSTEPKYKPLGKLKRARTVHRDSEEEDDYLFDDPLPIPLRHKVPYPETFHPEVFSMTAVSEKQPEKLRQTPGCCRAECMQSSRFTNFVDCEESNSESEEEVGIPASLQGDLGSVLHLQKADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTHISSQNSSQSTTEQGSQGWDSQSDT..... 257
12 -15.700sp|Q9BQ52|RNZ2_HUMAN Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens GN=ELAC2 PE=1 SV=2  ali   14  87.....................GTLAAVFVSHLHADHHTGLKPLHPLLVVAPNQLKAWLQQYHNQCQEVLHHISMIPAKCLQEGAETCDLEEFQTCLVRHCKHAFGCALVHTSGKVVYSGDTMPCEALVRM-----GKDATLLIHEATLEDGEEAVEKTHSTTSQAISVGMRMNAEFIMLNHFSQRYAKV--LFSPNFSEKVGV......................................................................................................................................................................................................................................................................................................................................... 295
13 -15.700sp|Q9NV88|INT9_HUMAN Integrator complex subunit 9 OS=Homo sapiens GN=INTS9 PE=1 SV=2  ali   11  95...........TVD-----------VILISNYHCMMALPYHTGFTGTVYATEPTVQIMEELVNFIERKIQLVGYSQKIEL------FGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTA---NPDGMVGEFCSNLALTVRNG--------G--NVLVPC................................................................................................................................................................................................................................................................................................................................................... 299
14 -13.900sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2  ali follow..  11  43..........ILIDT--TEFNTAIQEIVVTHWHRDHSGGICKSINNDTTYCIKKLPRNPQREEIIGNGEQQVYLKDGDVIKT-----EGATLRVLYTGHTDDHMALLLEEEN--AIFSGD---------CILGEGTTVFEDLYMNSL-IKADIIYPGHGPVIHNAEAKIQQYISHRN--------EQQILTLFRENFEKSFTVMELVKIIYKNTP-ENLHEMAKHNLLLHL............................................................................................................................................................................................................................................................................................................. 265
15 -13.800sp|Q68D91|MBLC2_HUMAN Metallo-beta-lactamase domain-containing protein 2 OS=Homo sapiens GN=MBLAC2 PE=1 SV=3  ali follow..  19  42..........VVIDT-KEDAARRPLLAVATHVHFDHSGGLYQ---DRVAVHHAEAEALARGDNFETVT-PTLILQDGDVINL---GDRQLTVMHMP-GHSRGSICLHDK--DRKILFSGDVVYDGSLIDWLPYSR-GTCERLIELVDRGLVEKVLPGHFNTFERLFRLASNYISKAGICHKVSTFAMRSLASLALRV............................................................................................................................................................................................................................................................................................................................................... 272
16 -13.300sp|O95571|ETHE1_HUMAN Protein ETHE1, mitochondrial OS=Homo sapiens GN=ETHE1 PE=1 SV=2  ali follow..  13  49..........VLIDQLIKELGLRLLYAVNTHCHADHITGLRSLLPGCQSVISRLSGAQADLH-----------IEDGDSIRF-----GRFALETRASGHTPGCVTFVLNDH--SMAFTGD--------------------ALLIRGC----RTDFQCAKTLYHSVHEKIFTLPGDCLIYPAHTVEEE-------RTLNPRLTLSCEEF.................................................................................................................................................................................................................................................................................................................................... 222
17 -12.900sp|Q16775|GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens GN=HAGH PE=1 SV=2  ali follow..  12  74..........AIVDDAARKHGVKLTTVLTTHHHWDHAGGLVKLESGLKVYGGDDR----------GALTHKITHLSTLQV-------GSLNVKCLATCHTSGHICYFVSKPGGSAVFTGDYEGTADEMCKALLEVLGRLPRVYCGHEYTINNLKFAPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTV........................................................................................................................................................................................................................................................................................................................................... 280
18 -12.600sp|Q9NV88|INT9_HUMAN Integrator complex subunit 9 OS=Homo sapiens GN=INTS9 PE=1 SV=2  ali   14  2............................................SASLWKNKDIQRLLPSPLK---SKIQLVGYSQKIEL------FGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTA---NPDGMVGEFCSNLALTVRNNVLVPCYPSGVYDLLECLYQYIDSPLYFSPVANSSLEFSQIFAEWLCHNKQSKVYL............................................................................................................................................................................................................................................................................................................. 207
19 -11.900sp|Q6PII5|HAGHL_HUMAN Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens GN=HAGHL PE=2 SV=1  ali follow..  13  26..........VAVDEIVGREGVSLTAVLTTHHHWDHARGLARLRPGLAVLGADER----------FSLTRRLAHGEELRF-------GAIHVRCLLTGHTAGHMSYFLWEDDPPALFSGDLEGSAQQMQSLAELGTLPPETVFCGHEHTLSNLEFAPCNDHVRAKLSWAKARPLSRRGKRVGGEGTGFGVGGALRQGLMVT........................................................................................................................................................................................................................................................................................................................................... 231
20 -11.600sp|Q8N490|PNKD_HUMAN Probable hydrolase PNKD OS=Homo sapiens GN=PNKD PE=1 SV=2  ali follow..  16  144..........VAVDASIEKEGVTLVAILCTHKHWDHSGGLSRRHRDCRVYGSPQDGI--------PYLTHPLCHQDVVSV-------GRLQIRALATGHTQGHLVYLLDGEGPSCLFSGDFEGNAETMSSLDTVLGLGDDTLWPGHEYAEENLGFAPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLAL........................................................................................................................................................................................................................................................................................................................................... 350
21 -11.300sp|A4D2B0|MBLC1_HUMAN Metallo-beta-lactamase domain-containing protein 1 OS=Homo sapiens GN=MBLAC1 PE=2 SV=1  ali follow..  15  80..........ILVDT----APGDVTLVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRL------------GPGLEVWATP-GHGGQRDVSVVVAGTALGTVVVALSEDPAAQERSRKRVLVVADVVV..................................................................................................................................................................................................................................................................................................................................................................................................... 228
22 -11.200sp|Q6IQ20|NAPEP_HUMAN N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Homo sapiens GN=NAPEPLD PE=1 SV=2  ali follow..  13  139.....MDELIFLTDPCTISELPPIDAVLISHNHYDHL-------------DYNSVIALNERFGNELRWFVPLGLLDENVIELD-PGHDKVTFVFTPSQHWCKRTLWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGPFDLAAIYEPRWFMKYQHVDP--EEAVRIHTD-VQTKKSMAIHWGTFALANEH-YLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF............................................................................................................................................................................................................................................................................................................... 393
23 -9.320sp|Q9P2I0|CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2  ali   11  1................................................................................................AGHMIGGTIWKIVKDGEEIVYAVDFHKREIHLNGCSLEMLSRPSLLITDSFNATYVQ--PRRKQRDEQLLTNVLETLRGNVLIAVDTAGRLELAQLLDQIWRTKALLNNVSYNVVEFSKSQVEWMSDKLMRCFEDKRNNPFQFRHLSLCHGLSDLARVPSP------------KVVLASQPDLE-SRDLFIQWDPKNSIILTYRTTPGTLARFLIDNPSEKITEIELRKRVKLEGKELEEYLEKEKLKKEAAKKLEQSKEADIDSSD......................................................................................................................................................................... 271

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.