current user: public

If you have questions about the server, please let us know.

Query: sp|Q6B0K9|HBM_HUMAN Hemoglobin subunit mu OS=Homo sapiens GN=HBM PE=2 SV=1, from H.sapiens

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQRMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKYRLast
1 -6.700sp|Q9Y6D6|BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens GN=ARFGEF1 PE=1 SV=2  ali   25.....RTRGLTVMFEIMKTYGHTYEKHWWQDLFRI---FRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKTCNCTLDIFKTTIP 160
2 -6.470sp|Q5TH69|BIG3_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Homo sapiens GN=ARFGEF3 PE=1 SV=3  ali   31..RQHQPPTLDLLFELLRDVTKTPGPGFGIYAVVHLPVMSVWLRRSHKDHSYANFKHAIGLSCELVVEHIQSFSMINTMLKDLFELLVACVAKPTETISRVGCSCIRYVLVTAGPVFTEEM---WRLACCALQDAFSA... 178
3 -6.450sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1  ali   16  10VLCHRASVFYRVGWPLPAIEVDFPEGIDRYKHFARFLLEGQVFRKLASYR--SCLLSSPGTMLKTWARLQPRTESL---LRALVAEKADCHEALLAAWKKNPKYLLAEYCEWLPQAMHPDIEKAW................ 129
4 -6.200sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=3  ali   10  15..QDVHRVLVARIIHAVTKGCCSQTDGLNSKFLDFFSKAIQCARQEKSSSGLNHILAALTIFLKTLARVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYI--KGAKTQEKGAYESTKWRSILYNLYDLLVNEIS 159
5 -5.500sp|Q8N7X0|CAN7L_HUMAN Calpain-7-like protein OS=Homo sapiens GN=C6orf103 PE=2 SV=3  ali   11  13..NISVADTLQKVWAVLEMNLEQYAVSLLRLMFKSKCKSLESYPCYQDEETKIAFADYTVTY............................................................................... 72
6 -5.320sp|Q13393|PLD1_HUMAN Phospholipase D1 OS=Homo sapiens GN=PLD1 PE=1 SV=1  ali   11  4IQDPVSDKFFKEVWVSTAAR----NATIYDKVFRCLPN-----DEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPS............................................. 90
7 -5.280sp|Q9P2D8|UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens GN=UNC79 PE=2 SV=3  ali   12  60LAYIQDHMLIASLWRVVKSEFSQLSVPLLLHALSLPHGADIFWTIINGNFNSKDWKMR-YSLAHAFCCFLTAVEDVNPAVATRAGLLLDT--IKRPALQGLDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQ. 238
8 -5.130sp|Q9Y6D5|BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens GN=ARFGEF2 PE=1 SV=3  ali   99.....RTRGLTVMFEIMKSYGHTFEKHWWQDLFRI---FRIFDNMKLPEQLSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFAQWCVKQDNEQLARSGTNCLENLVISNGEKFSPEVWDETCNCMLDIFKT... 231
9 -5.090sp|Q5TIA1|MEI1_HUMAN Meiosis inhibitor protein 1 OS=Homo sapiens GN=MEI1 PE=2 SV=2  ali   17  27......VRSLQGSLKMNNIELHKQGLLLFAEILTRQPEEIKLFT------SSAMCRDAGRALQEAVSSPVLEVEALKATSAFLRKDHQSTPPVQYGELQALLEA..................................... 120
10 -4.950sp|Q92736|RYR2_HUMAN Ryanodine receptor 2 OS=Homo sapiens GN=RYR2 PE=1 SV=3  ali   2............................VEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPMLCSY-------NNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGID-----EGAWMKRLAVFSQPIINKVK 112

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.