current user: public

If you have questions about the server, please let us know.

Query: sp|B5MD39|GGTL3_HUMAN Putative gamma-glutamyltransferase light chain 3 OS=Homo sapiens GN=GGTLC3 PE=5 SV=1, from H.sapiens

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGYLast
1 -101.0004gdx_B mol:protein length:195 Gamma-glutamyltranspeptidase 1 light chain  ali model follow..  93  1..............................TPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 195
2 -86.3005bpk_C mol:protein length:225 Gamma-glutamyltranspeptidase (Ggt)  ali model follow..  30  1....................................TTHYSVADRWGNAVSVTYTINASYGSAASIDGAGFLLNNEMDDFSIPGNPNLYGLVGGDANAIEANKRPLSSMSPTIVL-KNNKVFLVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWLPDELRIEKGMPADVKDNLTKMGYQIVTKPV-MGDVNAIQVKGSVFYGSTDPRKEFGTGS. 192
3 -78.1002v36_B mol:protein length:193 GAMMA-GLUTAMYLTRANSPEPTIDASE SMALL CHAIN  ali model follow..  32  1....................................TTHFTVADRWGNVVSYTTTIEQLFGTGIMVPDYGVILNNELTDFDAI---------PGGANEVQPNKRPLSSMTPTILF-KDDKPVLTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSMSS-YRYEDGVPKDVLSKLNGMGHKFGTSPVDIGNVQSISIDNGTFKGVADSSRNGAAIGI 180
4 -76.5005Y8X Entity 2(prereleased)  ali follow..  32  1....................................TTHFTVTDQWGNVVSYTTTIEQLFGTGILVPGYGLFLNNELTDFD---------AIPGGANEVQPNKRPLSSMTPTIVF-KDEKPVLTVGSPGGTTIIASVFQTILNYFEYGMSLQDAIEEPRIYTNSLTS-YRYESGMPEDVRRKLNDFGHKFGSNPVDIGNVQSIFIENKTFMGVADSSRNGTAVG. 179
5 -76.5005xlu_B mol:protein length:187 Gamma glutamyl transpeptidase  ali model follow..  32  1....................................TTHFTVTDQWGNVVSYTTTIEQLFGTGILVPGYGLFLNNELTDFD---------AIPGGANEVQPNKRPLSSMTPTIVF-KDEKPVLTVGSPGGTTIIASVFQTILNYFEYGMSLQDAIEEPRIYTNSLTS-YRYESGMPEDVRRKLNDFGHKFGSNPVDIGNVQSIFIENKTFMGVADSSRNGTAVG. 179
6 -69.7003g9k_S mol:protein length:177 Capsule biosynthesis protein capD  ali model follow..  21  1....................................TTHFVIIDRDGTVVSSTNTLSNFFGTGKYT--AGFFLNNQLQNFG-----------SEGFNSYEPGKRSRTFMAPTVLK--KDGETIGIGSPGGNRIPQILTPILDKYTHGKGSLQDIINEYRFTFE--KNTAYTEIQLSSEVKNELSRKGLNVKKKVSFFGGVQALIKDDNVITGAGDGRRNGTWKS. 175
7 -68.2002e0w_A mol:protein length:556 Gamma-glutamyltranspeptidase  ali model follow..  31  330LTNKAYAKSIADQIDINKAKPSSEIRPGLAPYESNQATHYSVVDKDGNAVAVTYTLNTTFGTGIVAGESGILLNNQMDDFSAPGVPNVYGLVGGDANAVGPNKRPLSSMSPTIVV-KDGKTWLVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEAKGQKVALKEAMGSTQSIMVGPDGELYGASDPRSDDLTAGY 556
8 -67.5005hft_B mol:protein length:187 Gamma-glutamyltranspeptidase  ali model follow..  26  1....................................TVWMGVVDNSGLAVSFIQSIYHEFGSGVVLPDTGIVWQNRGAAFS---------LDPQHLLALAPGKQPFHTLNPAAAR-LNDGRVMVYGSMGGDGQPQTQAALFTRYILQGVPLQESISRPRWTWGQSSDSLKLEGRFAPACIARLRELGHDVEVLADFMGHAGAIVRHNGLLEGATDPRSNGAAAGY 187
9 -60.3004y23_A mol:protein length:585 Gamma glutamyl transpeptidase,Gamma-glutamyltranspeptidase  ali model follow..  27  348LLDPDYIKERQKLISLDSMNRDVKEGPQPEDKTIGEATHFTVTDQWGNVVSYTTTIEQLFGTGILVPGYGLFLNNELTDFD---------AIPGGANEVQPNKRPLSSMTPTIVF-KDEKPVLTVGSPGGTTIIASVFQTILNYFEYGMSLQDAIEEPRIYTNSLTS-YRYESGMPEDVRRKLNDFGHKFGSNPVDIGNVQSIFIENKTFMGVADSSRNGTAVG. 577
10 -53.9002nlz_A mol:protein length:547 Cephalosporin acylase  ali model follow..  25  328LLSDEYATERRKEIGEQALTPEPGT------PPRGGTVYLATADGDGNMVSFIQSNYMGFGSGVVVPGTGIAMQNRGHNFS---------LDPNHDNALKPGKRTYHTIIPGFLT-KNDQPIGPFGVMGGFMQPQGHMQVMMNTIDFGLNPQAALDAPRWQWT-NGKQVQVEPTFPVDIAQALVRRGHKIQVVLGAFGRGQIIWRTTGVLAGGTEPRTDGQVAAW 539
11 -50.4002i3o_A mol:protein length:516 Gamma-glutamyltransferase related protein  ali model follow..  18  326...............................NDIGDTTYFSISDSEGRSVSIIQSNYMGFGSGIVPKGTGFVLQNRGSYFT---------LQRDHPNALMPGKRTFHTLAACMVE-KEHDLYASLGSMGGDIQPQVQMQILMEILKDNTDPQAILDKPRWTEPYTPGAVYVESELYRNVSKQISGRKVVLRDVSQEFGTAQITTLRGDVVVGAADPRGDGIAIPY 515

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.