current user: public

If you have questions about the server, please let us know.

Query: sp|P07108|ACBP_HUMAN Acyl-CoA-binding protein OS=Homo sapiens GN=DBI PE=1 SV=2, from H.sapiens

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGILast
1 -65.0002cb8_A mol:protein length:87 ACYL-COA-BINDING PROTEIN  ali model follow..  100  1MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI 87
2 -63.4001aca_A mol:protein length:86 ACYL-COENZYME A BINDING PROTEIN  ali model follow..  93  1.SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI 86
3 -63.1002fdq_A mol:protein length:86 Acyl-CoA-binding protein  ali model follow..  88  1.SQAEFDKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNQLKGTSKEDAMKSYIDKVEELKKKYGI 86
4 -62.1003epy_A mol:protein length:89 Acyl-CoA-binding domain-containing protein 7  ali model follow..  62  5..QADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI 89
5 -61.2001st7_A mol:protein length:86 Acyl-CoA-binding protein  ali model follow..  48  2..SQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYS. 85
6 -60.2005h3i_A mol:protein length:95 Putative Acyl-CoA-binding protein  ali model follow..  46  8..QEEFEEFAEKAKTLPDTISNEDKLLLYGLYKQATVGPVTTGRPGIFNLKDRYKWDAWKAVEGKSKEEAMADYITKVKQLLEEAS. 91
7 -60.2005h3g_A mol:protein length:94 Putative Acyl-CoA binding protein (ACBP)  ali model follow..  48  7..QEDFEQYAEKAKTLPESTSNENKLILYGLYKQATVGDVNTARPGIFAQRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLLEEAA. 90
8 -57.7001hbk_A mol:protein length:89 ACYL-COA BINDING PROTEIN  ali model follow..  27  3..AQVFEECVSFINGLPRNLPNELKLDLYKYYKQSTIGNCNIKEPSAHKYIDRKKYEAWKSVENLNREDAQKRYVDIVSEIFPYWQ. 88
9 -57.3002cop_A mol:protein length:109 Acyl-Coenzyme A binding domain containing 6  ali model follow..  40  9..AELFEKAAAHLQGLIQVASREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKKLDPGWN. 92
10 -56.3002lbb_A mol:protein length:96 Acyl CoA binding protein  ali model follow..  40  5..ADDFDAAVKYVSNTTTMASNDDKLCFYKYYKQATVGDCNKPKPGMLQLQEKYKWEAWNALRGMSTESAKEAYVKLLDTLAPSWR. 89
11 -56.1002wh5_A mol:protein length:106 ACYL-COA-BINDING DOMAIN-CONTAINING PROTEIN 4  ali model follow..  44  9..QKQFQAAVSVIQNLPKRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVI. 96
12 -56.0003fp5_A mol:protein length:106 Acyl-CoA Binding Protein  ali model follow..  54  3MSKAKFDKAVEIVQSLPKKPTQDEQLYFYKYFKQATVGDVNISRPGLMDFTGKAKWDAWKSVEGTSKEVAYQKYVEKLLEILKKAD. 92
13 -55.5005ijm_A mol:protein length:106 Uncharacterized protein  ali model follow..  40  4MSAADFEAAVAYVRSLPKQLDNAAKLQFYSLYKQATEGDVTGSQPWAVQVEARAKWDAWNSCKGMKSEDAKAAYVRRLLTLLRSQG. 93
14 -54.8002cqu_A mol:protein length:116 peroxisomal D3,D2-enoyl-CoA isomerase  ali model follow..  41  17..QKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAARQNYVDLVSSLSPSLE. 100
15 -54.7003flv_A mol:protein length:119 Acyl-CoA-binding domain-containing protein 5  ali model follow..  38  19..ETRFEAAVKVIQSLPKQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEMKKIIETMP. 106
16 -10.0001mix_A mol:protein length:206 Talin  ali model follow..  17  22.....YVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNLPKEYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSL-KTYGV 116
17 -9.7903g9w_A mol:protein length:223 Talin-2  ali model follow..  17  33.....YVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKPKEYIKQRGAE-QEHKNCGEMSEIEAKVKYVKLARSL-RTYGV 128
18 -9.7201y19_B mol:protein length:202 Talin 1  ali model follow..  14  8.....YVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSL...... 97
19 -9.5404f7g_A mol:protein length:222 Talin-1  ali model follow..  14  27.....YVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSL...... 116

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.