current user: public

If you have questions about the server, please let us know.

Query: sp|P36268|GGT2_HUMAN(removed signalp:1-30) Gamma-glutamyltranspeptidase 2 OS=Homo sapiens GN=GGT2 PE=1 SV=3, from H.sapiens

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .
# Score Template Links and tools%idFirst KEPDNHVYTRAAMAADAKQCLEIGRDTLRDGGSAVDAAIAALLCVGLMNAHSMGIGVGLFLTIYNSTTGKAEVINAREVAPRLAFASMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAVLENKRTVIEQQPVLWYVFCRDRKVLREGERLTLPRLADTYEMLAIEGAQAFYNGSLMAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSARLSGPVLALILNILKGYNFSRESVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCLTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAALDSRKGGEPAGYLast
1 -141.0002e0w_A mol:protein length:556 Gamma-glutamyltranspeptidase  ali model follow..  29  15DVFHPVRAKQGMVASVDATATQVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSK-NGNTTAIDFREMAPAKATRDMFLDDQGSLTSHLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDGFIVNDALADDLKTYGSELPNHENSKAIFWKEGEPLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSAD----AMQIMAEAEKYAYADRSYLGDPDFVKVP--WQALTNKAYAKSIADQIDINKAKPSSEIRPGLAPYESNQATHYSVVDKDGNAVAVTYTLNTTFGTGIVAGESGILLNNQMDDFSAPGVPNVYGLVGGDANAVGPNKRPLSSMSPTIVV-KDGKTWLVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEAKGQKVALKEAMGSTQSIMVGPDGELYGASDPRSDDLTAGY 556
2 -128.0004y23_A mol:protein length:585 Gamma glutamyl transpeptidase,Gamma-glutamyltranspeptidase  ali model follow..  28  33DGDKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETKETSIINSRERAPEGAKPDMFLDEDGRSRHGNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQDKL-SKTAAKDIFLPDGEPLKEGDILVQKDMAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYDPKSFE----KYHLLAETMHLSYADRAYAGDPEFVDVP--LRGLLDPDYIKERQKLISLDSMNRDVKEGPQPEDKTIGEATHFTVTDQWGNVVSYTTTIEQLFGTGILVPGYGLFLNNELTDFDAI---------PGGANEVQPNKRPLSSMTPTIVF-KDEKPVLTVGSPGGTTIIASVFQTILNYFEYGMSLQDAIEEPRIYTNSLTS-YRYESGMPEDVRRKLNDFGHKFGSNPVDIGNVQSIFIENKTFMGVADSSRNGTAVG. 577
3 -126.0002nlz_A mol:protein length:547 Cephalosporin acylase  ali model follow..  25  14SRRNVVYAKNGMVATSQPLAAQAGLDILKAGGNAIDAAIATATALTVLEPTSNGIGSDAFALVWTK--GKLHGLNGSGRAPMSLTMEAVKAKGLPPYGVIPVTVPGAPGAWAELAKMYGNLPLAASLAPAIRYAEEGYPVTPTLAKYWKAAYDRVKTEQPWFDTFAPKGRAPRVGEVWRSQGHADTLRSIAESNGESFYRGELADQIHAFFDKHGGYLTKEDLACYRPEWVEPISIDYRGYRVWEI-PPNGQGLVALEALNIVKGFEFYHKD------TVDTYHKQIEAMKLAFVDGMYVTEPSDMSVS--VEQLLSDEYATERRKEIGEQALTPEP------GTPPRGGTVYLATADGDGNMVSFIQSNYMGFGSGVVVPGTGIAMQNRGHNFS---------LDPNHDNALKPGKRTYHTIIPGFLT-KNDQPIGPFGVMGGFMQPQGHMQVMMNTIDFGLNPQAALDAPRWQWT-NGKQVQVEPTFPVDIAQALVRRGHKIQVVLGAFGRGQIIWRTTGVLAGGTEPRTDGQVAAW 539
4 -122.0002i3o_A mol:protein length:516 Gamma-glutamyltransferase related protein  ali model follow..  19  3RSRPNALSQRSVIASSSELASLAGRDILKRGGNIFDAALAVSAMLCVTQNNLCGLGGDLFALIRDE-NGQIMDLNGSGQASRAVSIDYYESMGLTKIPYAAITVPGIAGSWDEIFRKFATMDIADILEPAIRTASAGFPITQNYSDSIARSAPVIGQYRGWSSIFMPNGSVPVAGEILKQPDLAESFRLMSEEGFRSFYDGSLADIIIAGLEGTGSPLSDRDLRVYRPLIGKPVFTDLDEFRIYET-SPNSQGITVIEWIRGMESHGYDSRTMWEAK-----IEDIFETMEEAYDKRRKITDPSYMNIA--QHDSANGKKDGLPKRD-----------------HNDIGDTTYFSISDSEGRSVSIIQSNYMGFGSGIVPKGTGFVLQNRGSYFT---------LQRDHPNALMPGKRTFHTLAACMVE-KEHDLYASLGSMGGDIQPQVQMQILMEILKDNTDPQAILDKPRWTEPYTPGAVYVESELYRNVSKQISGRKVVLRDVSQEFGTAQITTLRGDVVVGAADPRGDGIAIPY 515
5 -109.0004gg2_A mol:protein length:353 Gamma-glutamyltranspeptidase 1 heavy chain  ali model follow..  94  4KEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYTPDDGG............................................................................................................................................................................................. 353
6 -98.7004gdx_A mol:protein length:374 Gamma-glutamyltranspeptidase 1 heavy chain  ali model follow..  95  31KEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSAPLSGPVLALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEF.................................................................................................................................................................................................... 373
7 -90.7003a75_A mol:protein length:384 Gamma-glutamyltranspeptidase large chain  ali model follow..  27  13EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGRVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKL-SRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWE----KYQLLAETMHLSYADRAYAGDPEFVNVP--LKGLLHPDYIKERQQLINLDQVNKKPKAGD--PWKYQEGSANYKQVEQPKDKVEG............................................................................................................................................................................. 377
8 -87.2005Y8X Entity 1(prereleased)  ali follow..  26  33DGDKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETRETSIINSRERAPEGAKPDMFLDEDGRSRHGNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQDKL-SKTAAKDIFLPDGEPLKEGDILVQKDLAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQVLKLIDDFHLSQYDPKSFE----KYHLLAETMHLSYADRAYAGDPEFVDVP--LRGLLDPDYIKERQKLISLDSMNRDVKEG-DPWKYEEGEPNYEIVPQPEDKTIG.............................................................................................................................................................................. 397
9 -87.2005y9b_A mol:protein length:398 Gamma glutamyl transpeptidase  ali model follow..  26  33DGDKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETRETSIINSRERAPEGAKPDMFLDEDGRSRHGNAVGVPGTLKGLEAAHKKWGTKKLEDLISPSIKLTEEGFPIDSVLADAIKDHQDKL-SKTAAKDIFLPDGEPLKEGDILVQKDLAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQVLKLIDDFHLSQYDPKSFE----KYHLLAETMHLSYADRAYAGDPEFVDVP--LRGLLDPDYIKERQKLISLDSMNRDVKEG-DPWKYEEGEPNYEIVPQPEDKTIG.............................................................................................................................................................................. 397
10 -86.5002qm6_A mol:protein length:377 Gamma-glutamyltranspeptidase  ali model follow..  27  20SYPPIKNTKVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLA-NGENVALDFREKAPLKATKNMFLDKQGSEDGYLAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEARERFLKYSSSKKYFFKKGLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVKWRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALGYGASK----NIHIAAEAMRQAYADRSYMGDADFVSVP--VDKLINKAYAKKIFDTIQPDTVTPSSQIKPGMGQLHEGSN............................................................................................................................................................................................ 371
11 -84.8003whq_A mol:protein length:418 Gamma-glutamyltranspeptidase large chain  ali model follow..  27  47EYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGRVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKL-SRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWE----KYQLLAETMHLSYADRAYAGDPEFVNVP--LKGLLHPDYIKERQQLINLDQVNKKPKAGD--PWKYQEGSANYKQVEQPKDKVEG............................................................................................................................................................................. 411
12 -84.7005hft_A mol:protein length:364 Gamma-glutamyltranspeptidase  ali model follow..  25  17HMHSSNVSTHGMAVAPHHLASQSALAILREGGSAIEAMVAAAAAIAVVYPHMNGLGGDGFWLIVPP-EGDPIAIDASGAAGSLATLEAYAGQRHIPNPQAALTVAGTVSGWVEALRISRALPVARLLADAIGYAEDGIPVTASQAHATASKLEELRHQPGFSETWLVAGEAPRPGSRFRQPALAGTLRMLASDGLDSFYRGPLAERLAQGMAALGMPITLGDLQAHRARRPGPLTLQHQQGTLWNL-APPTQGLVSLAILGITDRLKMADAD------DAQTVHRIVEATKRAFALRDHITDPRHLDVD--VQQLLTPEALQPLADSIDDASASPWGGGKG...................................................................................................................................................................................................... 355
13 -83.2005bpk_A mol:protein length:379 Gamma-glutamyltranspeptidase (Ggt)  ali model follow..  26  28SYPPIKNTKVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLA-NGENVALDFREKAPLKATKNMFLDKQGSEDGYLAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEARERFLKYSSSKKYFFKKGLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVKWRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALGYGASK----NIHIAAEAMRQAYADRSYMGDADFVSVP--VDKLINKAYAKKIFDTIQPDTVTPSSQIKPG--MGQLHEGSN.......................................................................................................................................................................................... 379
14 -82.4003g9k_L mol:protein length:323 Capsule biosynthesis protein capD  ali model follow..  27  11KIDSMGDKGTYGVSASHPLAVEEGMKVLKNGGSAVDAAIVVSYVLGVVELHASGIGGGGGMLIISKDKET--FIDYRETTPYFTGN-----------QKPHIGVPGFVAGMEYIHDNYGSLPMGELLQPAINYAEKGFKVDDSLTMRLDLAKPRI--YSDKLSIFYPNGEPIETGETLIQTDLARTLKKIQKEGAKGFYEGGVARAISK-----TAKISLEDIKGYKVEVRKPVKGNYMGYDVYTA-PPPFSGVTLLQMLKLAEKKEVYKDVDHTAT----YMSKMEEISRIAYQDRKNLGDPNYVNMD--PNKMVSDKYISTMKNENGDALSEAE........................................................................................................................................................................................................... 320
15 -74.7004gdx_B mol:protein length:195 Gamma-glutamyltranspeptidase 1 light chain  ali model follow..  92  1........................................................................................................................................................................................................................................................................................................................................................TPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 195
16 -67.3005bpk_C mol:protein length:225 Gamma-glutamyltranspeptidase (Ggt)  ali model follow..  30  1..............................................................................................................................................................................................................................................................................................................................................................TTHYSVADRWGNAVSVTYTINASYGSAASIDGAGFLLNNEMDDFSIPGNPNLYGLVGGDANAIEANKRPLSSMSPTIVL-KNNKVFLVVGSPGGSRIITTVLQVISNVIDYNMNISEAVSAPRFHMQWLPDELRIEKGMPADVKDNLTKMGYQIVTKPV-MGDVNAIQVKGSVFYGSTDPRKEFGTGS. 192
17 -59.9002v36_B mol:protein length:193 GAMMA-GLUTAMYLTRANSPEPTIDASE SMALL CHAIN  ali model follow..  32  1..............................................................................................................................................................................................................................................................................................................................................................TTHFTVADRWGNVVSYTTTIEQLFGTGIMVPDYGVILNNELTDFDAI---------PGGANEVQPNKRPLSSMTPTILF-KDDKPVLTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSMSS-YRYEDGVPKDVLSKLNGMGHKFGTSPVDIGNVQSISIDNGTFKGVADSSRNGAAIGI 180
18 -59.9005Y8X Entity 2(prereleased)  ali follow..  31  1..............................................................................................................................................................................................................................................................................................................................................................TTHFTVTDQWGNVVSYTTTIEQLFGTGILVPGYGLFLNNELTDFDAI---------PGGANEVQPNKRPLSSMTPTIVF-KDEKPVLTVGSPGGTTIIASVFQTILNYFEYGMSLQDAIEEPRIYTNSLTS-YRYESGMPEDVRRKLNDFGHKFGSNPVDIGNVQSIFIENKTFMGVADSSRNGTAVG. 179
19 -59.9005xlu_B mol:protein length:187 Gamma glutamyl transpeptidase  ali model follow..  31  1..............................................................................................................................................................................................................................................................................................................................................................TTHFTVTDQWGNVVSYTTTIEQLFGTGILVPGYGLFLNNELTDFDAI---------PGGANEVQPNKRPLSSMTPTIVF-KDEKPVLTVGSPGGTTIIASVFQTILNYFEYGMSLQDAIEEPRIYTNSLTS-YRYESGMPEDVRRKLNDFGHKFGSNPVDIGNVQSIFIENKTFMGVADSSRNGTAVG. 179
20 -59.2003g9k_S mol:protein length:177 Capsule biosynthesis protein capD  ali model follow..  21  1..............................................................................................................................................................................................................................................................................................................................................................TTHFVIIDRDGTVVSSTNTLSNFFGTGKYT--AGFFLNNQLQNFG-----------SEGFNSYEPGKRSRTFMAPTVLK--KDGETIGIGSPGGNRIPQILTPILDKYTHGKGSLQDIINEYRFTFE--KNTAYTEIQLSSEVKNELSRKGLNVKKKVSFFGGVQALIKDDNVITGAGDGRRNGTWKS. 175
21 -54.9005hft_B mol:protein length:187 Gamma-glutamyltranspeptidase  ali model follow..  26  1..............................................................................................................................................................................................................................................................................................................................................................TVWMGVVDNSGLAVSFIQSIYHEFGSGVVLPDTGIVWQNRGAAFS---------LDPQHLLALAPGKQPFHTLNPAAAR-LNDGRVMVYGSMGGDGQPQTQAALFTRYILQGVPLQESISRPRWTWGQSSDSLKLEGRFAPACIARLRELGHDVEVLADFMGHAGAIVRHNGLLEGATDPRSNGAAAGY 187

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.