current user: public

If you have questions about the server, please let us know.

Query: sp|P07108|ACBP_HUMAN Acyl-CoA-binding protein OS=Homo sapiens GN=DBI PE=1 SV=2, from H.sapiens

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGILast
1 -60.100PF00887.19; B7PHH9_IXOSC/19-99; Acyl CoA binding protein  ali follow..  34  1..KEVFAAATQHVQSNTGLLSTDHLLYLYARYKQAHEGSCKAPKPAFYDIKGKQKWDAWNKLGDLCETSAMREYVERVEQLFP.... 81
2 -7.250PF02315.16; B1M2D4_METRJ/6-92; Methanol dehydrogenase beta subunit  ali follow..  17  18............................YDGQTCKAPGNCWQPKPGFPEKVAGTKYDPKHDPKEVSKQAESIKQMEERNR....... 69
3 -7.200PF04939.12; A0A0C4EHR2_PUCT1/24-192; Ribosome biogenesis regulatory protein (RRS1)  ali follow..  12  34SARDSIQVLVNKLFGLPTSLTDDGVVANLPSGGPTTTLPRSKRLP---KPKPLTKWQKFANEKGIAPKPKRDRMETEKQEWVNRWG. 118
4 -6.430PF10504.9; A7SZ56_NEMVE/14-169; Protein of unknown function (DUF2452 topsan)  ali follow..  12  56..AEQIRHLQEQARKVLEETKRDAELQIYSLYKRNN-------GTTYFSMLGPQEWGSWTKAEDIERRSKDIRMVDNILA....... 155
5 -6.240PF11515.8; K7IQ42_NASVI/2523-2600; Mouse development and cellular proliferation protein Cullin-7  ali follow..  14  1..RSDFLSVDEYAIYVRDNVKSGMLVRCCKTYEEVEYGDVKIDPEGLHDLNVQVSWQH............................. 60
6 -5.890PF10680.9; G2XY60_BOTF4/41-109; RNA polymerase I specific transcription initiation factor  ali follow..  22  1...............LDELRNRDLSLHLYNAFAELTVHGEDEDQDDSNGFAPPKKWTAW............................ 54
7 -5.870PF02847.17; SGD1_SCHPO/566-680; MA3 domain  ali follow..  17  10VGSEDYIDAWERVLKLHLKRNQLPEIKLYNPFYGLVALKCCTLQHNLKKSFQFSLWDFFNELQPDDDSEEREISMRRIVNLAKLYA. 106
8 -5.830PF07152.12; G2IUH4_PSEUL/23-195; YaeQ protein  ali follow..  12  17LDRSYYASHNLTLALHPSETVERMMLRLFARHASDTKGISEDDEPDLWQKNYSDEIELWIELGEPDEKRLRK............... 94
9 -5.690PF09088.11; Q4WDL2_ASPFU/127-317; MIF4G like  ali follow..  13  108..APSLGRAIRFLYRSLDTIDLELMHRFLDWFAH------------LSNFGFTWKWSEWIEDLELPLVHPRMAFITGAIDKEIRLSF 181
10 -5.500PF11408.8; A7TDN2_VANPO/1149-1228; Sgs1 RecQ helicase  ali follow..  19  6......NFAFERIKAAVVEISNRSNLPLSTYMPVNAIKKIATFLP--------ATEDEFVVLLGDNEQNRRKDLRHVIMNLRKH... 77

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 2 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Shiryaev SA, Ratnikov BI, Chekanov AV, Sikora S, Rozanov DV, Godzik A,Wang J, Smith JW, Huang Z, Lindberg I, Samuel MA, Diamond MS, Strongin AY. Cleavage targets and the D-arginine-based inhibitors of the West Nile virus NS3 processing proteinase. Biochem J. 2006 Jan 15;393(Pt 2):503-11.